lighttpd-1.4.55-lp151.3.6.1<>,$^|下/=„zpgv6iX'dFP8.Ⱥާȯ:ښH@vKx4 NI1}ͲEqj9DTEݑ3I3* ї0-Kǃ,C8HQm' 8֟:C>s}TW'sd O*yQPCI?d   V$1 Jn EJj<j j j j .j /(j0j2j5|5j7H7%8%:%(;8;(%9;%:>%=Љ>Б?Й@СFЩGjHljIjXԀYԔ\j]xj^bhcdީeޮfޱl޳ujvp,wjxjyhcz'08>Clighttpd1.4.55lp151.3.6.1A Secure, Fast, Compliant, and Very Flexible Web ServerLighttpd is a secure, fast, compliant, and very flexible Web server that has been optimized for high-performance environments. It has a very low memory footprint compared to other Web servers and takes care of CPU load. Its advanced feature set (FastCGI, CGI, Auth, Output-Compression, URL-Rewriting, and more) makes lighttpd the perfect Web server software for every server that is suffering load problems.^|obs-power8-05-openSUSE Leap 15.1openSUSEBSD-3-Clausehttp://bugs.opensuse.orgProductivity/Networking/Web/Servershttps://www.lighttpd.net/linuxppc64le/usr/sbin/groupadd -r lighttpd >/dev/null 2>&1 ||: /usr/sbin/useradd -g lighttpd -s /bin/false -r -c "user for lighttpd" -d /var/lib/lighttpd lighttpd >/dev/null 2>&1 ||: test -n "$FIRST_ARG" || FIRST_ARG="$1" # disable migration if initial install under systemd [ -d /var/lib/systemd/migrated ] || mkdir -p /var/lib/systemd/migrated || : if [ "$FIRST_ARG" -eq 1 ]; then for service in lighttpd.service ; do sysv_service="${service%.*}" touch "/var/lib/systemd/migrated/$sysv_service" || : done else for service in lighttpd.service ; do # The tag file might have been left by a preceding # update (see 1059627) rm -f "/run/rpm-lighttpd-update-$service-new-in-upgrade" if [ ! -e "/usr/lib/systemd/system/$service" ]; then touch "/run/rpm-lighttpd-update-$service-new-in-upgrade" fi done for service in lighttpd.service ; do sysv_service="${service%.*}" if [ -e /var/lib/systemd/migrated/$sysv_service ]; then continue fi if [ ! -x /usr/sbin/systemd-sysv-convert ]; then continue fi /usr/sbin/systemd-sysv-convert --save $sysv_service || : done fi test -n "$FIRST_ARG" || FIRST_ARG="$1" [ -d /var/lib/systemd/migrated ] || mkdir -p /var/lib/systemd/migrated || : if [ "$YAST_IS_RUNNING" != "instsys" -a -x /usr/bin/systemctl ]; then /usr/bin/systemctl daemon-reload || : fi if [ "$FIRST_ARG" -eq 1 ]; then if [ -x /usr/bin/systemctl ]; then /usr/bin/systemctl preset lighttpd.service || : fi elif [ "$FIRST_ARG" -gt 1 ]; then for service in lighttpd.service ; do if [ ! -e "/run/rpm-lighttpd-update-$service-new-in-upgrade" ]; then continue fi rm -f "/run/rpm-lighttpd-update-$service-new-in-upgrade" if [ ! -x /usr/bin/systemctl ]; then continue fi /usr/bin/systemctl preset "$service" || : done for service in lighttpd.service ; do sysv_service=${service%.*} if [ -e /var/lib/systemd/migrated/$sysv_service ]; then continue fi if [ ! -x /usr/sbin/systemd-sysv-convert ]; then continue fi /usr/sbin/systemd-sysv-convert --apply $sysv_service || : touch /var/lib/systemd/migrated/$sysv_service || : done fi test -n "$FIRST_ARG" || FIRST_ARG="$1" if [ "$FIRST_ARG" -eq 0 -a -x /usr/bin/systemctl ]; then # Package removal, not upgrade /usr/bin/systemctl --no-reload disable lighttpd.service || : ( test "$YAST_IS_RUNNING" = instsys && exit 0 test -f /etc/sysconfig/services -a \ -z "$DISABLE_STOP_ON_REMOVAL" && . /etc/sysconfig/services test "$DISABLE_STOP_ON_REMOVAL" = yes -o \ "$DISABLE_STOP_ON_REMOVAL" = 1 && exit 0 /usr/bin/systemctl stop lighttpd.service ) || : fi test -n "$FIRST_ARG" || FIRST_ARG="$1" if [ "$FIRST_ARG" -ge 1 ]; then # Package upgrade, not uninstall if [ -x /usr/bin/systemctl ]; then /usr/bin/systemctl daemon-reload || : ( test "$YAST_IS_RUNNING" = instsys && exit 0 test -f /etc/sysconfig/services -a \ -z "$DISABLE_RESTART_ON_UPDATE" && . /etc/sysconfig/services test "$DISABLE_RESTART_ON_UPDATE" = yes -o \ "$DISABLE_RESTART_ON_UPDATE" = 1 && exit 0 /usr/bin/systemctl try-restart lighttpd.service ) || : fi else # package uninstall for service in lighttpd.service ; do sysv_service="${service%.*}" rm -f "/var/lib/systemd/migrated/$sysv_service" || : done if [ -x /usr/bin/systemctl ]; then /usr/bin/systemctl daemon-reload || : fi fi5w@iUfF</P{}O( (     H H p8H p Hhx X ` H P( z 5_.JzL &P K~.VQ Np&nAA聠A聠AA큤AAAAA^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^|^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^|^|^|^|^|^|^|^|f45d09334766ce774c9dc90f00a1a645fa64de14e222e647a464c4307a4976d9aec61660e6a34dba4079420341e09353746888da8dcda0c1e5f8b0f57488d8c86ab9a143eeb02c106754b8c5e38685ef29adb774483e1dcfb8a482d65e8cba005615542e73a99e25cecf6da6db128046476907d046319bf35441e8ea67c7df5e44e10f874c6aa9717af0be89eec4dbfd3747e92fa2572d42b18cb17ca35c48f9e67fa1c23d311c01d678c65dc971e4ef6988a8dc6379c30846a69a20f4448c31395adfcd8c07307816fb6a0541a11091e2f1b599d61192a1e4ae0354d5cc4dfb3eb9f7bd00fa03269ee834f1fe22c0f9a16b06a64745baa74ed521dcae7df7cd74b3906e82498ada1ffc02d5d2b145f502aaf191ba9189fe13c014dcc61f5f7509d6405336b5881a03ab9408ca17e57697ba10ac9638704774ac1b6ad32e89271d50c95afdc2ce1bd53e2817a2edab374ab73ba0011f769994da167cd6e6db7122ce54a7a4cf8b8e52ce06a5b485a0e444e67865ad044f68e8262d9708e6cfd25caf0df87385952b4800edb4ed7113bae33a668b27945ec9335ee80edf6949db7dae00d74566f9ac7713a4e251d789191bc662003bcee7e5ff568a2b135ee0163865c44af5f71df24e05171a6a70b1d8daa0e0c2c379d508d4bc36ac7c36f1de3cf5ac7ed07301a8affc51bc3bedb623f49c2f561bc0796766a7cfad6a7a46ac0a481920acb16c6baeb564d9e1c17b2ac84bb79ecbfc06227cffb6f9bbcde7f0e4b410a368c42aa45556d8987870f112bbe7539fa8e0cb5285a7b34ba43e3b92d1a07df97e931e98a76f2c18e51f69197c0744d24b555cd474c4f9b04e008d9a764f9f1735e6d3e8acb3b5d9ed5facf6120dc18ef6aae512e964f4444c3761e4c41e60fbb6c36fb48146882dd278a9a3f158d7aee074190e4eaacd0ac0f455322037d1bd92c0451d4c9c10a8aaa08d48d99081befb74cf6dc71c9106de825f1435ea2859925d3e5afae2332cebcb7951531d65602c8411839bd015495285b98df322028ee9b4db6f837f0d9769b3fe7985716a120fd10e0bff77582fd66e859df064cf46d1f646532b0f34f88460da6925d4319de348cc67be3b016bd2ea456dd714566500cd64673505aae50c844678d302cc21bf50835d3fa45fc4fbcca67604ecb2c247215ea37e2e5fef71113eee4b8d5c55ac70f94bf716d4eca3911ffa677faabe4dad010f10ff0bf0c64241a3c6c86d025c4c82d586dc6a22b70c43103b2494d1a021b221de9c3febb58fb843e6654845537dd67a2120dac8f6321073c23bba142eb8e8eac83a7c71bdf317a22a09db966aa070c1f1e69bb399ee66f6bcdc657f7fb6e2e1fca8f578f9b82746fd8826ea84e2e76d1be89383871f480bda9a8718310181478d41e225f1e3feb556632e7a05e659d96f1503c03eb7c226be7595c7c3ac2c8317caf69c964c6ce79b7f41278dc6f64e8c3bd27e76a14e8379f61bf85d167a16a5f6f78dbd0e37ee2f14e800f75dc44b3c94ab25f8c927aaff9f87a1eed9bf3c2d55a18cdf0dd8050ef63f9cb7569a8767f8c33e6d02dd0e0e1ddf4433025db50a7dcaf21342b7322efc1c4e535ac259aafa080f0cbb855f42fb7e9d11c6b989ac507b5bfa29827bca8461c017f79d66bd8ce09a453cb7c34cf61bdf67811ea3221ca2838877cb31654e3937ae35ca25fb2d6a09bdad59c1e592b965c735f677b3296cccc2b28ee7d9ca4320c04b9d5ee249a13572de98c8a1f6b9d552accb0cdba7cd608001ead5f60a3ceca057d5d5b76539c683fcebf8fa242474833358242d141ee23e2385b7ca498b069d2c0a44d24dc990537ed7e4e638c85899bf381433cfcdc21dacfdb2415277837c94a2b9b80f20b1a1ef12f2a675c41ef790464412d6d338fa3e53f7750fb6d72e9b64f8921e5c08fe84f62ed0de30064742f0044d5244220ba23292d7f630acb6ee1259e1171f0ec7d62b58da943dfa9d0800213e9cc40e5fbbb91992386e932c4152eab06163a61cc3868b086a4f71f20eee71b6f29c1e649b6e01c5cbd1360065f37a03448b0ada87e670721eb5bd3b4d8113bf86cf00479678946867ad93b3b14e1bc1453301d249e702fc40c7daa04bcd233b5d5418e8f03c43b85ef1f35f9e70791cdf0fb7d1c8dd9b2c155d552bd082f9f4b59a125d77a2e100ca7e0cec54dec7fe0157969256631bcafb7171effe8af9ff2077db2e13064a0665b2a618f34556bbe9df7dd7a4795929bde17559d8c73f109e7e6c6134025c07439cce5da738c4302f757d2bfa119930b83a3d3371f40475950bf6c8d59bc08c9bca5c1927227d37e028594956c7f6f1b1965f1a1032d49ac469e13f8a09840a33272bd63e082a263f171d630936fdb9e23c2c675753f7c976a1458c67de81fa4435ffde6bc7fff9e54ca606ce057c1b7354dc87c171a20bc9b2e21ce9f21aed620ddcf7fb0e3503e7ff858a721d1027cb09aeefd9bf0e8e0ee5758441a1f1237579bf633454d53618890d532b9983c8c4f690e4a19e5389943890d22f77141fd60d90f7137af531117aa62a3b6be9b1ef6a3d69c432b93c203a5563ef67585baaba026cd1adebb2265df4e67328de1bba4bc14e1bdb020ea58e489a69187b1d5a864fde57f96f6428e0231704ccaa77843d36c7f07d76684749d04c80d2222b456e87644951ddc7963b0665575865762568e47db2e54b6e636544f054239984eabf9269311f0eee78cb0e39198aea24ac61a4dc4d05d70eaee89a94d12d4b7d868ec0a22273ab5462a906d229962cf55ae4d7eb2bc6e611f009667e2dd0cca3398c3979cbd5ae54d3d193afc07e164c1056b9221db1bf4c10a41402bb0a9453f814360f6a67863c195dacb44785b1f387e664325e981ce1db887cddee41b99915fbb47e7ae430ffef1c30c88218478e51b4c826e58c18a48cffa96e5a510e2bd05000d2cb076fa3322b0f5645fc2e46dde49bb7f3b1ff4aecb6ce388c610f25618c410b3313050fd5ca11a8c7f7dc0d8784f48ca50de8fdd7cc384d50204523f7aa541ab4480ea5154e71b2b6c2e974139fc1a5d4e9225e11e47764329a402a0051373a50e23216c5f3fb49c4cbcd1c0b5c3ef283fca9ada4d69aa83309c5139377b76e0abdc30e78ecf531c18d3177564a071a51c69df1bff4c34ef6115be29ddfac2335a3b53c8d318e532784b3e8ca86f118f333b49c07a1748e8812b2d1499c30904ad40c57b6ecfd36cb8cfb621054db8c5bc6e36ef10f23a1ec6d0667bc2032f7bab5d7101322041ef85a0256f0da59b3b32172841f272c6cdbda9223450827b0bf97a4d642870f4313cb2fafa12b4b6ec12972305b30546c9ea5c759411bd869885e5fe1dd216bf228dd1ae25299868c24f3baf8ce1172f29487724fd7f257d7e5540a2df25b52d32dafa7b02119e00cab53851facfef4d2681ef49ec0cc388c2448f84411e5e21badac7ab6dc1ab5926f4c0df9d1c7a8c4fe685feb4e15911b0b646fd40a29ec2afb7c818853631fbede70454c3d9e0e97a3e4491e80fcc3b00cc853d2726d940328e30967474c29f243fd140d51fdc5361c75e56059d03a520030d171558366263815a658ae3db848a8feac19b9e4b264a64be0b5e1b7e7ba58398ab0567c4ba317d7dbb1e4742323773f34caea9f1baa28b34192589434685887ad18efde3a5cd89a3342eb2ac783e253ac404c6d8b6b435e1422bdf0bbe3a4992ff25610181f7e3fa22d540f1940729bc6721839dc9d364b8d4c9629e472b09d9f42b8f1aa99e17e2f48a756a0d9732306b4d13dc563a1e08aecfb5063b0fbb18a0f85e7d5d9250a180a93ee36bb70637a7b0e74d7d8b14ae8a475d98e28cf8f1f127cc3e3ecfb1c8b4ddc32bc6f987ca9f4bec792d4835b4457a70b3679ba18748ffbd0a38c62bd082261305a4f7b1ae9d61246c2b21680adfd675eb5ff3730db086f33c5cb14e558422ca504e4e8899575bc02a4bef009aee00fbf47f1ecd1dfcadd993b5194ddbef469649bb8df455751b644432cd79a5810fe03b94bcc227fb23a98c7c545c5d696d600e332ccaaa5831371be437031332b716d8f45fde44137e5ae30c2f1fe59171f49be53bb2c412a430f9d5e253b65594fefb5367ca7bc974ecb7e877463d40a459d97035861604381019b1ec47d5163ecfb56f406f4592182cdc53f2477d2192f09e73cdd947ec8ad37328afcaa4ff2e5315ce014c8ef8a87934589ec7123293a191566ddfa4a575f142d2e26db998622d95d5badd886e4c63a0f0c73e397servicerootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootlighttpdlighttpdlighttpdlighttpdlighttpdlighttpd-1.4.55-lp151.3.6.1.src.rpmconfig(lighttpd)http_daemonhttpdlighttpdlighttpd(ppc-64) @@@@@@@@@@@@@@@@@@    /bin/sh/bin/sh/bin/sh/bin/shconfig(lighttpd)coreutilsdiffutilsfillupgreplibattr.so.1()(64bit)libattr.so.1(ATTR_1.0)(64bit)libbz2.so.1()(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.17)(64bit)libc.so.6(GLIBC_2.25)(64bit)libcrypt.so.1()(64bit)libcrypt.so.1(GLIBC_2.17)(64bit)libcrypto.so.1.1()(64bit)libcrypto.so.1.1(OPENSSL_1_1_0)(64bit)libdl.so.2()(64bit)libdl.so.2(GLIBC_2.17)(64bit)libev.so.4()(64bit)libfam.so.0()(64bit)libpcre.so.1()(64bit)libssl.so.1.1()(64bit)libssl.so.1.1(OPENSSL_1_1_0)(64bit)libz.so.1()(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)shadowspawn-fcgisystemdsystemdsystemdsystemd1.4.55-lp151.3.6.13.0.4-14.6.0-14.0-15.2-14.14.1^b;@^6]]@Z@Zb@Za@Za@Zx@Z@Z7Y+@Y@Y@XCX|XzXzXs{@X^c@X2@X2@XkW@W!VU@U@UȒ@UU@UUTTTT\@T_W@Vítězslav Čížek Andreas Stieger Andreas Stieger Dominique Leuenberger dimstar@opensuse.orgi@marguerite.sumikhail.kasimov@gmail.commikhail.kasimov@gmail.comjenkins@lighttpd.netrbrown@suse.comstbuehler@web.destbuehler@web.destbuehler@web.demrueckert@suse.demrueckert@suse.debwiedemann@suse.comstbuehler@web.dejenkins@lighttpd.netstbuehler@web.dejenkins@lighttpd.netjenkins@lighttpd.netstbuehler@web.dejenkins@lighttpd.netjenkins@lighttpd.netjenkins@lighttpd.netjenkins@lighttpd.netdimstar@opensuse.orgjenkins@lighttpd.netmrueckert@suse.dejenkins@lighttpd.netjenkins@lighttpd.netstbuehler@web.detchvatal@suse.comtchvatal@suse.comtchvatal@suse.comtchvatal@suse.comLed - Remove deprecated GeoIP support (bsc#1156198) * drop mod_geoip subpackage- update to 1.4.55: * a multitude of bug fixes- update to 1.4.54 (boo#1111733): * behavior change: strict URL parsing and normalization (configurable) * performance enhancements * bug fixes - includes changes from 1.4.53: * TLS-ALPN-01 * systemd socket activation * bug fixes - includes changes from 1.4.52: * performance enhancements * bug fixes - includes changes from 1.4.51: * new module: mod_authn_pam * multiple security fixes + process headers after combining folded headers + mod_userdir security: skip username "." and ".." - includes changes from 1.4.50: * CVE-2018-19052: path traversal in mod_alias (boo#1115016) * security: use-after-free after invalid Range request * multiple bug fixes - Fix build with PostgreSQL 11 in Tumbleweed (boo#1153722) - Switch to unmodified upstream tarball, add upstream signing keys and verify source signature- BuildRequire pkgconfig(systemd) instead of systemd: allow OBS to shortcut the build queues by allowing usage of systemd-mini- Revert that pgsql workaround for tumbleweed: pampering over issues like this is just hiding problems. A real fix was submitted to the postgresql package instead.- workaround for tumbleweed * update-alternatives not expanded in the build VM due to unknown reasons, thus /usr/bin/pg_config is meaningless- Updated 10-ssl.conf (TLSv1.2 only) for lighttpd.conf in lighttpd_1.4.49-1.1.debian.tar.xz- Updated 'SSL Support' section in lighttpd.conf: TLSv1.2 only bsc#1087369- update to 1.4.49 + - next is 1.4.49 + [core] adjust offset if response header blank line + [mod_accesslog] %{canonical,local,remote}p (fixes #2840) + [core] support POLLRDHUP, where available (#2743) + [mod_proxy] basic support for HTTP CONNECT method (#2060) + [mod_deflate] fix deflate of file > 2MB w/o mmap + [core] fix segfault if tempdirs fill up (fixes #2843) + [mod_compress,mod_deflate] try mmap MAP_PRIVATE + [core] discard from socket using recv MSG_TRUNC + [core] report to stderr if errorlog path ENOENT (fixes #2847) + [core] fix base64 decode when char is unsigned (fixes #2848) + [mod_authn_ldap] fix mem leak when ldap auth fails (fixes #2849) + [core] warn if mod_indexfile after dynamic handler + [core] do not reparse request if async cb + [core] non-blocking write() to piped loggers + [mod_openssl] minor code cleanup; reduce var scope + [mod_openssl] elliptic curve auto selection (fixes #2833) + [core] check for path-info forward down path + [mod_authn_ldap] auth with ldap referrals (fixes #2846) + [core] code cleanup: separate physical path sub + [core] merge redirect/rewrite pattern substitution + [core] fix POST with chunked request body (fixes #2854) + [core] remove unused func + [doc] minor update to *outdated* doc + [mod_wstunnel] fix for frames larger than 64k (fixes #2858) + [core] fix 32-bit compile POST w/ chunked request body (#2854) + [core] add include sys/poll.h on Solaris (fixes #2859) + [core] fix path-info calculation in git master (fixes #2861) + [core] pass array_get_element_klen() const array * + [core] increase stat_cache abstraction + [core] open additional fds O_CLOEXEC + [core] fix CONNECT w strict header parsing enabled + [mod_extforward] CIDR support for trusted proxies (fixes #2860) + [core] re-enable overloaded backends w/ multi wkrs + [autoconf] reduce minimum automake version to 1.13 + [mod_auth] constant time compare plain passwords + [mod_auth] check that digest realm matches config + [core] fix incorrect hash algorithm impl + [doc] NEWS- Replace references to /var/adm/fillup-templates with new %_fillupdir macro (boo#1069468)- new upstream release 1.4.48 + requires automake 1.14 + new mod_authn_sasl module - remove autoreconf call; was required for mod_geoip patch, which is now upstream - add cyrus-sasl-devel, package mod_authn_sasl- update to 1.4.47 + [core] stricter validation of request-URI begin + [core] fix 1.4.46 regression in config match + [core] normalize config addrs for != match + [core] normalize config addrs for eq and ne + [core] fix 1.4.46 regression in Last-Modified- new upstream release 1.4.46 - drop lighttpd-1.4.x_out_of_bounds_read.patch (fixed upstream) - use systemd, drop init script - drop support for suse_version <= 1210 - add some new modules and packages - drop __DATE__/__TIME__ sed hack (usage disabled upstream by default)- use php7 for TW (boo#1058101)- added lighttpd-1.4.x_out_of_bounds_read.patch: fix out of bounds read in mod_scgi (debian#857255)- make lighttpd user own /var/log/lighttpd/ to be able to write logs there- fix some rpmlint messages + update FSF address for lighttpd.init + install example scripts without +x to avoid pulling shell dependencies + W:file-contains-current-date /usr/sbin/lighttpd is a false positive; it only happens when the last-source-modified date is the same as the build date + I: binary-or-shlib-calls-gethostbyname has been forwarded upstream- update to 1.4.45 + - next is 1.4.45 + [mod_cgi] skip local-redir handling if to self (fixes #2779, #2108) + [mod_webdav] fix crash when plugin_ctx cleaned up (fixes #2780) + [mod_fastcgi] detect child exit, restart proactively + [mod_scgi] detect child exit, restart proactively + [TLS] ssl.read-ahead = "disable" for low mem (fixes #2778) + [doc] NEWS + [tests] update test skip count for !fcgi-responder + [tests] FCGI_Finish() final request before exit + [tests] give time for periodic jobs to detect exit + [mod_cgi] check cgi fd for num bytes ready to read- lighttpd-1.4.13_geoip.patch is long gone; it was replaced with mod_geoip-for-1.4.39.patch but is now included upstream- update to 1.4.44 + - next is 1.4.44 + [mod_scgi] fix segfault (fixes #2762) + [mod_authn_gssapi] fix memory leak + [config] warn if mod_authn_ldap,mysql not listed + [mod_magnet] fix magnet_cgi_set() set of env vars (fixes #2763) + [mod_cgi] FreeBSD 9.3/MacOSX does not have pipe2() (fixes #2765) + [mod_extforward] fix crash on invalid IP (fixes #2766) + [mod_fastcgi] fix segfault if all backends down (fixes #2768) + [mod_cgi] fix out of sockets error for POST to CGI (fixes #2771) + [mod_auth] compile fix for Mac OS X XCode (fixes #2772) + [mod_authn_gssapi] better resource cleanup + [core] compile fix for Mac OS X 10.6 (old) (fixes #2773) + fix race in dynamic handler configs (reentrancy) (fixes #2774) + [mod_authn_mysql] close mysql_conn in cleanup + [mod_webdav] compile fix when locking not enabled + load mod_auth & mod_authn_file in sample/test.conf + comment out auth.backend.ldap.* in tests/*.conf + [mod_fastcgi,mod_scgi] warn if invalid "bin-path" + RAND_pseudo_bytes() is deprecated in openssl 1.1.0 + openssl 1.1.0 init and cleanup + [mod_cgi] remove direct calls to network_backend* + [build] build network_*.c into lighttpd executable + suggest inclusion of mod_geoip... before mod_ssi. + set systemd settings similar to lighttpd2 + [doc] remove reference to Linux rt-signals + [mod_authn_gssapi] fix missing error ret, coverity + [core] rename li_rand() to li_rand_pseudo_bytes() + remove #include "stream.h" where not used + [mod_cml] include lua headers before base.h + [core] combine duplicated connection reset code + [mod_ssi] produce content in subrequest hook + [core] remove srv->entropy[] + [core] defer li_rand_init() until first use + [core] permit connection-level state in modules + [mod_dirlisting] render dirlisting as HTML (fixes #2767) + [mod_proxy] replace HTTP Host sent to backend (fixes #2770) + [mod_ssi] basic recursive SSI include virtual (fixes #536) + [mod_ssi] implement, ignore + [core] consolidate duplicated read-to-close code + [core] fix segfault when parsing a bad config file + [core] support Transfer-Encoding: chunked req body (fixes #2156) + [autobuild] set NO_RDYNAMIC=yes for midipix + [mod_proxy] proxy.balance = "sticky" option (fixes #2117) + [mod_secdownload] warn if SHA used w/o SSL crypto + [build] compile fixes for AIX + [build] check for pipe2() at configure time + [mod_evhost] fix an incorrect error trace + [tests] mark tests/docroot/www/*.pl scripts a+x + [mod_proxy] proxy.replace-http-host enable/disable + [mod_cgi] fall back to pipe() if pipe2() fails + fix SCons fullstatic build with glibc pthreads + [TLS] openssl 1.1.0 makes SSL_OP_NO_SSLv2 no-op + [doc] NEWS- update to 1.4.43 + - next is 1.4.43 + [autobuild] remove mod_authn_gssapi dep on resolv + [mod_deflate] ignore '*' in deflate.mimetypes + minor: make packdist.sh more convenient for me + [autobuild] omit module stubs when missing deps + [autobuild] rm module stub code for missing deps + [TLS] openssl 1.1.0 hides struct bignum_st + [autobuild] move http_cgi_ssl_env() for Mac OS X (fixes #2757) + [core] use paccept() on NetBSD (replace accept4()) + [TLS] remote IP conditions are valid for TLS SNI (fixes #2272) + [doc] lighttpd-angel.8 (fixes #2254) + [cmake] build fcgi-auth, fcgi-responder for tests + [mod_accesslog] %{ratio}n logs compression ratio (fixes #2133) + [mod_deflate] skip deflate if loadavg too high (fixes #1505) + [mod_expire] expire by mimetype (fixes #423) + [mod_evhost] partial matching patterns (fixes #1194) + [mod_evhost] mod-evhost.t tests (#1194) + build: use CC_FOR_BUILD for lemon when cross-compiling + [lemon] standalone; remove #include "first.h" + [mod_dirlisting] config header and readme files + [config] warn if mod_authn_ldap,mysql not listed + fix FastCGI, SCGI, proxy reconnect on failure + [core] network_open_file_chunk() temp file opt + [mod_rewrite] add more info in error log msg + [core] fix fd leak when using libev (fixes #2761) + [core] fix potential streaming tempfile corruption (fixes #2760) + minor: coverity comments + [mod_scgi] fix prefix matching to always match url + move script to doc/scripts/ax_prog_cc_for_build.m4 + [autobuild] adjust Makefile.am for FreeBSD + [core] check fcntl O_APPEND succeeds w/ mkstemp() + [doc] NEWS + [autobuild] add lemon.c to src/Makefile.am + [autobuild] build fix for lemon.c + [autobuild] put ax_prog_cc_for_build.m4 in top directory + [scons] workaround FreeBSD11 fullstatic link error + [scons] only apply FreeBSD11 workaround on FreeBSD + [mod_cgi] FreeBSD 9.3 does not have pipe2() + [build] move some build scripts to scripts/ + [autotools] fix configure.ac for opensuse 13.2 + [build] fix warning for (potentially) unused func- package new modules - remove mod_geoip_for_1.4.40.patch- update to 1.4.42 + - next is 1.4.42 + [TLS] SSL_shutdown() only if handshake finished + [mod_proxy,mod_scgi] shutdown remote only if local (#2743) + [core] check if client half-closed TCP if POLLHUP (#2743) + [core] enforce wait for POLLWR after EINPROGRESS (fixes #2744) + [core] do not enter handler twice after read body + [core] proxy,scgi omit shutdown() to backend (fixes #2743) + [mod_dirlisting] dirlist does not handle POST + [mod_dirlisting] js column sort for dirlist table (fixes #613, fixes #2315) + [mod_auth] Digest auth fails after rewrite (fixes #2745) + [mod_auth] refactor out auth backend code + [mod_auth] refactor out auth backend code + [mod_auth] refactor out auth backend code + [mod_auth] extensible interface for auth backends + [mod_auth] extensible interface for auth backends + [core] better DragonFlyBSD support (fixes #2746) + [mod_auth] include base.h for USE_OPENSSL def + [mod_auth] support CRYPT-MD5-NTLM algorithm (fixes #1743) + [mod_auth] terminate salt for CRYPT-MD5-NTLM + [core] fix crash if ready events on abandoned fd (fixes #2748) + fix mis-cast in unused code + [mod_auth] http_auth_md5_hex2bin() + [mod_auth] remove empty mod_auth.h + [mod_auth] mod_authn_mysql.c MySQL auth backend (fixes #752, fixes #1845) + [mod_cgi] permit CGI exec of unreadable files (fixes #2374) + [mod_uploadprogress] add to default build + [mod_geoip] add to default build (fixes #2705, fixes #2101, fixes #2092, fixes #2025, fixes #1962, fixes #1938) + [mod_fastcgi] Authorizer support with Responder (fixes #321, fixes #322) + [tests] test coverage for issues (#321, #322) + dynamic handlers store debug flag in handler_ctx + [mod_fastcgi] allow authorizer, responder for same path/ext (#321) + backport mod_deflate to lighttpd 1.4 (fixes #1824, fixes #2753) + [autobuild] test_configfile might need vector.c (fixes #2752) + remove unused sys-mmap.h from stat_cache.c + [mod_deflate] fix longjmp clobber compiler warning + remove unused array type TYPE_COUNT data_count + [mod_auth] structured data, register auth schemes + [mod_auth] mod_authn_gssapi Kerberos auth backend (fixes #1899) + silence warnings from clang ccc-analyzer + [autobuild] skip two new tests if no fcgi-auth + [SCons] define with_krb5 for SCons build + [SCons] fix syntax error in SConstruct + [SCons] define with_geoip for SCons build + [CMake] fix clang -Wcast-align warnings in lemon.c + remove excess initializers (fix compiler warnings) + fix errors detected by Coverity Scan + performance: use Linux extended syscalls and flags + [mod_scgi] add uwsgi protocol support + [mod_auth] refactor LDAP code into smaller funcs + [mod_auth] HTTP Basic auth backends also do authz (#1817) + [mod_auth] ldap filter subst user for multiple '$' (fixes #1508) + [mod_auth] permit specifying ldap DN; skip search (fixes #1248) + [autobuild] update module/feature report + [cmake] build mod_authn_gssapi if WITH_KRB5 + DragonFlyBSD defines __DragonFly__ (#2746) + [mod_auth] fix printing of IP in error trace + quiet coverity warning + [mod_mysql_vhost] support multiple '?' replacement (fixes #2163) + [core] make server.max-request-size scopeable (#1901) + [core] server.max-request-field-size (fixes #2130) + [core] optional condition in config "else" clause (fixes #1268) + [core] restrict where config "else" clauses occur (#1268) + silence warnings from clang ccc-analyzer + consistent, shared code to create CGI env + [TLS] replace env entries in https_add_ssl_entries + [TLS] set SSL_CLIENT_M_SERIAL w/ client cert SN (fixes #2268) + [TLS] set SSL_CLIENT_VERIFY w/ client cert (#1288, #2693) + [TLS] set SSL_PROTOCOL, SSL_CIPHER* (fixes #2511) + [core] rand.[ch] to use better RNGs when available + [mod_cgi] fix pipe_cloexec() when no O_CLOEXEC + ignore return value from fcntl() FD_CLOEXEC + silence warnings from clang ccc-analyzer + fix SCons build + build w/o compiler warnings if no zlib or bz2lib + parallelize dist package build (packdist.sh) + [doc] NEWS + quiet coverity warning + add random() to list of rand() fallbacks- update to 1.4.41 + - next is 1.4.41 + remove long-deprecated, non-functional config opts + [config] inherit server.use-ipv6 and server.set-v6only (fixes #678) + [build] allow AUTHOR, KEYID overrides to packdist + [mod_auth] fix Digest auth to be better than Basic (fixes #1844) + [doc] update memcache references to memcached + [mod_ssi] fix #config sizefmt="bytes" + fix some warnings reported by cppcheck + workaround clang compiler warning + [autobuild] move inet_pton detection later + [core] #include for FIONREAD (fixes #2726) + [autobuild] clock_gettime() -lrt with glibc < 2.17 + minor: spelling changes in some comments/messages + [security] do not emit HTTP_PROXY to CGI env + [build_cmake] clock_gettime() -lrt w/ glibc < 2.17 (fixes #2737) + [core] avoid spurious trace and error abort + [core] stay in CON_STATE_CLOSE until done with req + [core] $HTTP["remoteip"] must handle IPv6 w/o [] + [mod_status] show keep-alive status w/ text output (fixes #2740) + do not set REDIRECT_URI in mod_magnet, mod_rewrite (#2738) + revert 1.4.40 swap of REQUEST_URI, REDIRECT_URI (fixes #2738) + [core] permit IPv6 address scope identifier + [core] consolidate duplicated response_end code + [TLS] better handling of SSL_ERROR_WANT_READ/WRITE + [TLS] read all available records from SSL_read() + [core] try AF_INET after AF_INET6 if use-ipv6 + [core] fix result copy from getaddrinfo() + [core] set chunkqueue tempdirs at startup + [core] check if EAI_ADDRFAMILY is defined + [core] set chunkqueue tempdirs at startup /var/tmp + [security] ensure gid != 0 if server.username set (fixes #2725) + [security] disable stat_cache if !follow-symlink (fixes #2724) + [core] fix buffer_copy_string_hex() assert (fixes #2742) + fix buffer.c comments to match encoded_chars_* + [security] encode quoting chars in HTML and XML + [cmake] always define _GNU_SOURCE + [cmake] enable warnings for GCC and Clang + [cmake] set cmake_minimum_required to 2.8.2 + [doc] NEWS- update to 1.4.40 + - next is 1.4.40 + [mod_ssi] enhance support for ssi vars + add handling for lua 5.2 and 5.3 (fixes #2674) + use libmemcached instead of deprecated libmemcache + add force_assert for more allocation results + cleanup dead keyvalue code + [autobuild] fix lua configure error handling + [mod_cgi] use MAP_PRIVATE to mmap temporary file instead of MAP_SHARED (fixes #2715) + [core] do not send SIGHUP to process group unless server.max-workers is used (fixes #2711) + [mod_cgi] edge case chdir "/" when docroot "/" (fixes #2460) + fix links to online docs in template config files + [mod_cgi] issue trace and exit if execve() fails (closes #2302) + [configparser] don't continue after parse error (fixes #2717) + [core] never evaluate else branches until the previous branches are aready (fixes #2598) + [core] fix conditional cache handling + [core] improve conditional enabling (thx Gwenlliana, #2598) + [buffer] use explicit integer promotion to make the code more readable + [config] extend duplicate-array-key error (fixes #2704) + [mod_compress] case-insensitive content-codings (fixes #2645) + [plugins] don't include dlfcn.h if not needed (fixes #2548) + [mod_fastcgi] 404 for X-Sendfile file not found (fixes #2474) + [mod_cgi] send 500 if CGI ends and there is no response (fixes #2542) + [mod_cgi] consolidate CGI cleanup code + [mod_cgi] simplify mod_cgi_handle_subrequest() + [mod_cgi] kill CGI if fail to write request body + [mod_proxy] use case-insensitive comparision to filter headers, send Connection: Close to backend (fixes #421) + [mod_dirlisting] dir-listing.hide-dotfiles = "enabled" by default (fixes #1081) + [mod_rewrite] fix return type of process_rewrite_rules + [mod_secdownload] fix buffer overflow in secdl_verify_mac (reported by Fortify Open Review Project) + [mod_fastcgi,mod_scgi] fix leaking file-descriptor when backend spawning failed (reported by Fortify Open Review Project) + [core] improve array API to prevent theoretical memory leaks + [core] rename variable in array.c + [core] refactor array search; raise array size limit to SSIZE_MAX + [core] fix memory leak in configparser_merge_data + [core] provide array_extract_element and use it + [core] configparser: error on duplicate keys in array merge (fixes #2685) + [core] more careful parse of $SERVER["socket"] config str (prepare #2204) + [core] accept $SERVER["socket"] without port, use server.port as fallback (fixes #2204) + [mod_magnet] define lua_pushglobaltable (for lua5.1) and use it (fixes #2719) + [ssl] support disabling ssl.verifyclient.activate in SNI callback (fixes #2531) + restart (some) syscalls after SIGCHLD interrupted them; should fix LDAP problems (fixes #2464) + [core] log remote address on request timeouts (fixes #652) + [autobuild] use AC_CANONICAL_HOST instead of AC_CANONICAL_TARGET (fixes #1866) + [core] fix request_start in keep-alive requests to mark time when received first byte (fixes #2412) + [core] truncate pidfile on exit (fixes #2695) + consistent inclusion of config.h at top of files (fixes #2073) + [autobuild] include first.h in make dist + [core] add generic vector implementation + [core] replace array weakref with vector + [base64] fix crash due to broken force_assert + [unittests] add test_buffer and test_base64 unit tests + [base64] fix another crash due to broken force_assert conditions + [buffer] refactor buffer_path_simplify (fixes #2560) + [http_auth/mod_fastcgi] check get_http_*_name() for NULL return (#2583) + validate return values from strtol, strtoul (fixes #2564) + add NEWS entry for previous commit + [mod_ssi] Add SSI vars SCRIPT_{URI,URL} and REQUEST_SCHEME (fixes #2721) + [config] warn if server.upload-dirs has non-existent dirs (fixes #2508) + [mod_proxy] accept LF delimited headers, not just CRLF (fixes #2594) + [core] wait for grandchild to be ready when daemonizing (fixes #2712, thx pasdVn) + [core] respond 411 Length Required if request has Transfer-Encoding: chunked (fixes #631) + [core] fixed the loading for default modules if they are specified explicitly + [core] lighttpd -tt performs preflight startup checks (fixes #411) + [stat] mimetype.xattr-name global config option (fixes #2631) + [configparser] fix small leak on config failure + [mod_webdav] allow Depth: Infinity lock on file (fixes #2296) + [mod_status] use snprintf() instead of sprintf() + pass buf size to li_tohex() + use li_[iu]tostrn() instead of li_[iu]tostr() + [stream] fstat() after open() to obtain file size + [core] clean up srv before exiting for lighttpd -[vVh] + [mod_fastcgi,mod_scgi] check for spawning on same unix socket (fixes #319) + [mod_cgi] always set QUERY_STRING (fixes #1339) + [mod_auth] send charset="UTF-8" in WWW-Authenticate (fixes #1468) + [mod_magnet] rename var for clarity (fixes #1483) + [mod_extforward] reset cond_cache for scheme (fixes #1499) + [mod_webdav] readdir POSIX compat (fixes #1826) + [mod_expire] reset caching response headers for error docs (fixes #1919) + [mod_status] page refresh option (fixes #2170) + [mod_status] table w/ count of con states (fixes #2427) + [mod_dirlisting] class for dir (fixes #2304) + skip spawning backends for preflight tests (#2642) + [core] define __STDC_WANT_LIB_EXT1__ (fixes #2722) + [core] setrlimit max-fds <= rlim_max for non-root (fixes #2723) + [mod_ssi] config ssi.conditional-requests + [mod_ssi] config ssi.exec (fixes #2051) + [mod_redirect,mod-rewrite] short-circuit if blank replacement (fixes #2085) + [mod_indexfile] save physical path to env (fixes #448, #892) + [core] open fd when appending file to cq (fixes #2655) + [config] server.listen-backlog option (fixes #1825, #2116) + [core] retry tempdirs on partial write, ENOSPC (fixes #2588) + untangle overly complex control flow logic + defer reading request body until handle subrequest (fixes #2541) + mv funcs from connections.c to connections-glue.c + defer reading request body until handle subrequest + always poll for client POLLHUP/POLLERR events (fixes #399) + remove handle_joblist hook + handlers can read response before sending req body (fixes #131, #2566) + [mod_cgi] asynchronous send of request body to CGI + improve dynamic handler control flow logic + [doc] add mimetype.use-xattr to conf.d/mime.conf + [doc] enhance error msg for backend server config + [doc] add ref to RFC 7232 for conditional requests + make (compile and link) cleanly under cygwin + [core] compile with upcoming openssl 1.1.0 release (fixes #2727) + fix some warnings reported by static analysis tool + [core] set REDIRECT_STATUS to error_handler_saved_status (fixes #1828) + remove unused con->error_handler member + [core] server.error-handler new directive for error pages (fixes #2702) + set REDIRECT_URI in mod_rewrite, mod_magnet + [doc] add server.error-handler + server.error-handler new directive for error pages + [core] support IPv6 in $HTTP["remote-ip"] CIDR cond match (fixes #2706) + [doc] NEWS + [core] http_response_send_file() shared code (#2017) + [mod_fastcgi] use http_response_xsendfile() (fixes #799, fixes #851, fixes #2017, fixes #2076) + [mod_scgi] X-Sendfile feature (fixes #2253) + [mod_cgi] X-Sendfile feature (fixes #2313) + [mod_cgi,mod_fastcgi,mod_scgi] X-Sendfile features + [mod_webdav] lseek,read if fs can not mmap (#2666, fixes #962) + [mod_compress] use mmap and trap SIGBUS (#2666, fixes #1879) + fallback to lseek()/read() if mmap() fails (#fixes 2666) + [mod_auth] skip blank lines and comment lines (fixes #2327) + [core] fallback to write if sendfile not supported (fixes #471, #987) + minor: add missing #include + [core] preserve PATH_INFO case on case-insensitive fs (fixes #406) + [doc] add mimetype.use-xattr to create-mime.conf.pl + [doc] NEWS + [mod_ssi, mod_cml] set DOCUMENT_ROOT to basedir (fixes #2383) + [core] cmd line opt to shutdown after idle time limit (fixes #2696) + [network] separate addr trans from socket creation + [core] lighttpd -1 handles single request on stdin socket (fixes #1584) + lighttpd run modes for idle timeout, one-shot + [mod_fastcgi,mod_scgi] IPv6 support (fixes #2372) + [mod_status] add JSON output option (fixed #2432) + [mod_webdav] map COPY/MOVE Destination to aliases (fixes #1787) + [mod_webdav] improve PROPFIND,PROPPATCH (#1818, #1953) + [mod_webdav] improve PROPFIND,PROPPATCH; map COPY/MOVE Destination + [doc] NEWS + reset response headers, write_queue for error docs + fix typo in new cgi.x-sendfile directives + clean up oneshot_fd resource upon startup error + minor: fix compiler warning for extra ';' + build with libressl + [core] fix IPv6 address + port parsing (#2204) + static build instructions using SCons or make + [core] fix config merge of array lists + [core] simplify config merge of array lists + [core] add default modules while processing server config + [mod_auth] preserve WWW-Authenticate for error docs (fixes #2730) + check close() return code after writing to file + [doc] NEWS + adjustments for openssl 1.1.0 pre-release + [config] support include file glob (fixes #1221) + [mod_evasive] 302 redirect option if limit reached (fixes #2199) + [build] enhancements for cross-compiling (fixes #2276) + [mod_accesslog] report aborted con state with %X (fixes #1890) + [mod_ssi] fix SSI statement parser + [mod_ssi] include relative to alias,userdir (fixes #222) + [mod_ssi] add PCRE_* options to constrain regex + [mod_ssi] more flexible quoting (fixes #1768) + [core] wrap IPv6 literal in "[]" in redirect URL + [mod_ssi] fix parse of tag across buf boundary (fixes #2732) + [mod_cgi,mod_scgi] X-Sendfile sets file_started (fixes #2733) + [mod_fastcgi] no chunked response w/ X-Sendfile (fixes #2733) + [config] opts for http header parsing strictness (fixes #551, fixes #1086, fixes #1184, fixes #2143, #2258, #2281, fixes #946, fixes #1330, fixes #602, #1016) + [config] normalize IP strings in lighttpd.conf + [build_cmake] use MODULE on Mac OS X (fixes #1761) + minor: quiet some compiler warnings + use buffer_string_set_length() to truncate strings + use buffer_string_set_length() to truncate strings + [config] server.bsd-accept-filter option + [mod_webdav] create file w/ LOCK request if ENOENT + [doc] NEWS + [mod_webdav] getetag and lockdiscovery live props + [mod_webdav] create file w/ LOCK request if ENOENT + [core] buffer large responses to tempfiles (fixes #758, fixes #760, fixes #933, fixes #1387, #1283, fixes #2083) + [core] stream response to client (#949) + [TLS] release openssl buffers as used (fixes #1265, fixes #1283, #881) + [config] config options to stream request/response (#949, #376) + [core] option to stream request body to backend (fixes #376) + separate routines for reading output from backends + [core] option to stream response body to client (fixes #949, #760, #1283, #1387) + drain backend socket/pipe bufs upon FDEVENT_HUP + http_response_backend_error() + remove excess calls to joblist_append() + defer choosing "Transfer-Encoding: chunked" + asynchronous, bidirectional streaming options + fix errors detected by Coverity Scan + [build] update Makefile.am EXTRA_DIST w/ new files + chunkqueue_append_chunkqueue() + fix errors detected by Coverity Scan + [cygwin] fix mod_proxy and mod_fastcgi ioctl use + use con->conf.server_tag in modules + [mod_webdav] remove excess SQL param to UNLOCK + [doc] NEWS + graceful shutdown without unnecessary 1 sec delay + fix error handling for portability (NetBSD) + [core] disable Nagle algorithm (TCP_NODELAY) + [core] add declarations to fdevent.h (#2373) + [build] add $(ATTR_LIB) to liblightcomp_la_LIBADD + [cygwin] minor: fix compiler warning + [tests] remove dependency on CGI.pm + [core] fix s6_addr type-punned compiler warning + [TLS] fix return value checks during cert init + [core] fix server.max-request-size to be precise (fixes #2131) + [mod_webdav] fix proppatch mem leak, other fixes (#fixes 1334, #fixes 2000) + [autobuild] CMake check for struct tm tm_gmtoff (fixes #2014) + [core] remove assert in fdevent_unregister() + [mod_uploadprogress] fix mem leak (#1858) + [core] make server.max-request-size scopeable (fixes #1901) + [mod_fastcgi,mod_scgi] check for spawning on same unix socket (#319) + [mod_fastcgi,mod_scgi] check for spawning on same unix socket (#319) + fix gcc 6.1.1 compiler warn misleading-indentation + [mod_accesslog] %a %A %C %D %k %{}t %{}T (fixes #1145, fixes #1415, fixes #2081) + [mod_access] new directive url.access-allow (fixes #1421) + [core] fdevent_libev: update use of ev_timer + [core] fdevent_libev: workaround compiler warning + [tests] remove some tests duplicated in mod-cgi.t + [mod_cgi] handle local redirect response (fixes #2108) + update lighttpd -h + [doc] add self to AUTHORS (discussed w/ stbuehler) + [doc] NEWS- update to 1.4.39 + -next is 1.4.38 + fix packdist.sh output links + [stat-cache] fix handling of collisions, might have returned wrong data (fixes #2669) + [core] allocate at least 4k buffer for incoming data + [core] fix search for header end if split across chunks (fixes #2670) + [core] check configparserAlloc() result with force_assert + [mod_auth] implement and use safe_memclear, using memset_s or explicit_bzero if available + [core] don't buffer request bodies smaller than 64k on disk + add force_assert for many allocations and function results + [mod_secdownload] use a hopefully constant time comparison to check hash (fixes #2679) + [config] check config option scope; warn if server option is given in conditional + [core] revert increase of temp file size back to 1MB, provide a configure option "server.upload-temp-file-size" instead (fixes #2680) + [core] add '~' to safe characters in ENCODING_REL_URI/ENCODING_REL_URI_PART encoding + [core] encode path with ENCODING_REL_URI in redirect to directory (fixes #2661, thx gstrauss) + [core] refactor base64 functions into separate file + [mod_secdownload] add required algorithm option; old behaviour available as "md5", new options "hmac-sha1" and "hmac-sha256" + [autobuild] fix missing header in tar ball + mod-auth.t: no crypt md5 for darwin + [tests] test apr-md5 in mod-auth.t + [tests] do not half-close socket before having received the response (fixes #2688) + [mod_fastcgi/mod_scgi] zero sockaddr structs before use (fixes #2691) + [network] add darwin-sendfile backend (fixes #2687) + [core] show correct crypt support result (fixes #2690) + - next ist 1.4.39 + [core] fix memset_s call (fixes #2698) + [chunk] fix use after free / double free (fixes #2700) + [scons] fix fullstatic build- Add perl(CGI) BuildRequires in order to be able to pass the test suite.- update to 1.4.37 + - next is 1.4.37 + [mod_proxy] remove debug log line from error log (fixes #2659) + [mod_dirlisting] fix dir-listing.set-footer not showing + fix out-of-filedescriptors when uploading "large" files (fixes #2660, thx rmilecki) + increase upload temporary chunk file size from 1MB to 16MB + fix undefined integer shift + rewrite network (write) backends + [cmake] lowercase commands, whitespace cleanup, remove clutter in else(...), endif(...), endforeach(...) + [cmake] cleanup cache variables if features get deactivated + fix some unchecked return value warnings + maintain cq->bytes_in in chunk API; keep bytes_out/bytes_in synced + [cmake] don't put date into config.h (not used anyway), only unset local vars for disabled features instead of clearing cache + [cmake] fix FreeBSD linker bug + [tests] search for perl in PATH instead of /usr/bin; whitespace + test config cleanups + [kqueue] fix kevent call + [tests] fix warning about newline in filename + [autoconf] define HAVE_CRYPT when crypt() is present + [bsd xattr] fix compile break with BSD extended attributes in stat_cache + [mod_dirlisting] remove sys/syslimits.h; base.h already includes limits.h + small README for FreeBSD build setup + [build] put --as-needed into linker flags instead of cflags + [mod_cgi] rewrite mmap and generic (post body) send error handling + [mmap] fix mmap alignment + [plugins] when modules are linked statically still only load the modules given in the config + [scons] various improvements + [mmap] handle SIGBUS in network; those get triggered if the file gets smaller during reading + [scons] fix crypt() detection, other improvements + [scons] fix build + fix some warnings found by coverity ("leak" in setup phase, not catching too long unix socket paths in mod_proxy) + packdist.sh: use fakeroot for make dist to have root owned files in tar- do not use the full url as we are reusing the debian tarball.- update to 1.4.36 + [configfile] fix reading uninitialized variable (found by Willian B.) + [dist] add dist-xz, remove dist-bzip2, allow ~rc appendix in packdist.sh- update to 1.4.36~rc1 + - next is 1.4.36 + use keep-alive timeout while waiting for HTTP headers; use always the read timeout while waiting for the HTTP body + fix bad shift in conditional netmask ".../0" handling + add more mime types and a script to generate mime.conf (fxies #2579) + fix typo in NEWS entry for #2579 + add support for (Free)BSD extended attributes + [build] use fortify flags with "extra-warnings" + [mod_dirlisting,mod_redirect,mod_rewrite] abort config parsing if pcre-compile fails or isn't available + [ssl] disable SSL3.0 by default + Fixed typo found by openSUSE user (boo# 907709) + add NEWS entry for previous commit + [network] fix compile break in calculation of sockaddr_un size if SUN_LEN is not defined (fixes #2609) + [connections] fix bug in connection state handling + print backtrace in assert logging with libunwind + fix buffer, chunk and http_chunk API + Remove chunkqueue_get_{append,prepend}* API + Remove buffer_prepare_copy() and buffer_prepare_append() + [tests] improve valgrind and strace TRACEME, disable condition logging in normal configs + Use buffer API to read and modify "used" member + rename buffer_append_long_hex to buffer_append_uint_hex + [buffer] constify some parameters + [bitset] unused -> remove + remove unused stuff from server.h + [crc32] fix method signature (const pointer) + [tests] fix undefined index warning in sendfile.php + [mod_auth] use crypt_r instead of crypt if available + fix error message for T_CONFIG_ARRAY config values if an entry value is not a string + fix segfaults in many plugins if they failed configuration + escape all strings for logging (fixes #2646 log file injection, reported by Jaanus Kääp) + add some until now missing files to dist tarball + minor spelling fixes + fix hex escape in accesslog (fixes #2559) + show extforward re-run warning only with debug.log-request-handling (fixes #2561) + parse If-None-Match for ETag validation (fixes #2578) + check pointer before usage in new etag compare + fix memory leak in mod_status when no counters are set (found by coverity) + #ifdef all parts belonging to the connection-state debugging + [mod_magnet] fix segfault when accessing not existing lighty.req_env[] entry (found by coverity) + fix segfault when temp file for upload couldn't be created (found by coverity) + check fcgi_env_add return value (found by coverity) + mime.conf: add some new mime types, remove .dat, .sha1, .md5, update .vcf + [mod_proxy] add unix domain socket support (fixes #2653)- define and use pkg_name, pkg_version, tarball_version - use debian orig tarball - fix download url- Deb .orig.tar.bz2 -> regular tar, hopefully it shall work.- Spec-cleanify and remove sle9 support fun - Fix rpmlint warnings - Use tarball fetchable from upstream - Remove all obsolete conditions- Remove the debian changelog also from the .spec file SOURCES- Remove debian changelog as it collides with factory checkers- fix bashisms in pre script/bin/sh/bin/sh/bin/sh/bin/shobs-power8-05 1585219812  !"#$%&'()*+,-./0123456789:;<=>?@ACDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijk1.4.55-lp151.3.6.11.4.55-lp151.3.6.11.4.55-lp151.3.6.1 lighttpdconf.daccess_log.confauth.confcgi.confcompress.confdebug.confdirlisting.confevhost.confexpire.conffastcgi.confmime.confmod.templateproxy.confscgi.confsecdownload.confsimple_vhost.confssi.confstatus.confuserdir.conflighttpd.confmodules.confvhosts.dvhosts.templatelighttpdlighttpdlighttpd-ssllighttpd.servicelighttpdmod_access.somod_accesslog.somod_alias.somod_auth.somod_authn_file.somod_cgi.somod_compress.somod_deflate.somod_dirlisting.somod_evasive.somod_evhost.somod_expire.somod_extforward.somod_fastcgi.somod_flv_streaming.somod_indexfile.somod_openssl.somod_proxy.somod_redirect.somod_rewrite.somod_scgi.somod_secdownload.somod_setenv.somod_simple_vhost.somod_sockproxy.somod_ssi.somod_staticfile.somod_status.somod_uploadprogress.somod_userdir.somod_usertrack.somod_vhostdb.somod_wstunnel.solighttpdlighttpd-angelrclighttpdlighttpdAUTHORSNEWSREADMEaccess.txtaccesslog.txtalias.txtauthentication.txtcgi.txtcompress.txtconfiguration.txtexpire.txtfastcgi-state.txtfastcgi.txtfeatures.txtperformance.txtplugins.txtproxy.txtredirect.txtrewrite.txtscgi.txtsecdownload.txtsecurity.txtsetenv.txtsimple-vhost.txtskeleton.txtspawn-php.shssi.txtssl.txtstate.txtstatus.txttraffic-shaping.txtuserdir.txtsysconfig.lighttpdlighttpd-angel.8.gzlighttpd.8.gzlighttpdcompresslighttpdsocketslighttpd/etc//etc/lighttpd//etc/lighttpd/conf.d//etc/lighttpd/vhosts.d//etc/logrotate.d//etc/sysconfig/SuSEfirewall2.d/services//usr/lib/systemd/system//usr/lib64//usr/lib64/lighttpd//usr/sbin//usr/share/doc/packages//usr/share/doc/packages/lighttpd//usr/share/fillup-templates//usr/share/man/man8//var/cache//var/cache/lighttpd//var/lib//var/lib/lighttpd//var/log/-fmessage-length=0 -grecord-gcc-switches -O2 -Wall -D_FORTIFY_SOURCE=2 -fstack-protector-strong -funwind-tables -fasynchronous-unwind-tables -fstack-clash-protection -gobs://build.opensuse.org/openSUSE:Maintenance:12187/openSUSE_Leap_15.1_Update_ports/eaa90769400a9aeb91e18cd49f842a90-lighttpd.openSUSE_Leap_15.1_Updatedrpmxz5ppc64le-suse-linux  !"#$%&''()*++directoryASCII textC source, ASCII textELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=795a9d174348b06cd17b4b39a873b0a2c556f0ec, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=454178a6bb9bacf4aae2acb47cbd83e964cf5475, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=1b4b2ab9246aa8acff48c6c72b5764e6dd2cccae, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=338f845572e2d39799de82c7d926adef0e717466, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=f6429df3c021f396c36fdbb4286812f18bd51a6c, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=1c434c855964b53ec243361a9b7107c18fb910e2, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=73f471284eec07b6005f8417c14f238250b0bd86, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=107e833140147686bb4cbdeceeb7dea136f34e8b, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=8803895653f29a7f2970458aecd0223daa745578, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=aac69c4c2af5dcb2ef1066b08e6567eb5744d925, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=7693640da6f4263b307e0567e6eece2a9a184dd0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=1654bc6c6c5955cc8554b3ddd0ae623200bdadf6, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=530af65153db8d44139b596836b0b375638f854f, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=2d36d4f86a8a7fd788cb90fa5a4ceadbe11f5df3, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=6cfe754814e427a867769b0a4c583d61787233c9, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=0946ba202c8e5d2975cb43f1dcdaba9762eb5079, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=d370c8e59c8286b0c9220e289a06b201751bef3f, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=5e912d95ad4497e3753fde1d351fc3f4b685aa9b, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=b5400ab58779b9884316137e4f7fb5ebfc6fea0a, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=a58ee1fba56953d5863b663747b69555a8ed9e0f, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=5013ffc00ebc0d3ff33d76c6d7e9986d85c468bc, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=73615cbfa6879c7cfcac359a009a6ee58582f1dc, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=c6a763f18241b0464775b8e0783f79222ebf5ba8, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=042053880a2cc671b2a7b7847bd679287461c500, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=785340d9e8919550b4803f2451cdead742c29725, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=96dfe4e4475458989ccc94c0a0089a51d209fd29, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=1ed7b3a62540b15cf4b78255f61c96e18d360c96, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=e130d389c9b086208fa87d39b91a8850dc527311, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=1d48d819ee626f4a413c8e8dc4f7fcb168b00240, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=ff6575e0854e1eeff42d5e236aa795dfe88d0ee8, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=54b3de976f144e9e928bb605d79b1b9838cae3c6, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=cdf9b389251f710e7bd8edfdd96d0fe8d8d28516, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=b341559e4be8b39a8a914fcae52eccd00f0c545f, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/l, BuildID[sha1]=1f5a3464d3b2600de0563db687ddbdb36657e4dc, for GNU/Linux 3.10.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/l, BuildID[sha1]=2d84a260508ec4e004e5f18b857d5523862c9363, for GNU/Linux 3.10.0, strippedUTF-8 Unicode textHTML document, ASCII textBourne-Again shell script, ASCII text executableexported SGML document, ASCII texttroff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix) !#%')+13579=?ACEGIKMOQUa R R R R R R RR RR RR RRRR R R R RR R R RR R R RR R R R R R R R R R R R R R R R RRRRR R R R R R R R R RR RR R R R R R R R R R R R R R R R R R R R R RR RR R RRRR RRR RRRR R R ^|xtb,lighttpd-mod_openssllogrotate1.4.55utf-8c14df628a1da8e332d8683cd5a8bea16789f6738a62ae7dd12c4f361b7357e2c?p7zXZ !t/=]"k%{U}g桙Ⲹ9,Y,ځ_q!vp3 Ra"O}/ / $y3Rg FmﺷmM%_)8A84~cWƅyLg{_.a Y39wnO@h  \,rK5EӋPi 3"bxGgWRw"pi$26 AHO\gM.#Rm6GW9gk;U'+Ɛ:e-~N؀ݫ<!u#0j `hJv/w#DDTSg:/;ǍB!m0K2^$6/\t;@4)o(am`~d>[!bSz[. W؏mڥlM^ |7cx7?ΪcG^0 bb5Q!m5lB+t4mXžofw+L! z/ǩyrߝ0iRVnF}OLpiH2v֋B=!9 4.?)P { ̽Yhv9u ۺqԩ rplZKk|[ޥ0H%? ,ʶ A=&`7D# `GhڒL4d;_dG&Qlwp=nw]PyMLEO߿ҟjgyxP€dm.at$IGb6a:߲=tXe-*'[  D@ =^1d1:$=f 1'eL< `(ϊ -\t=txS>œ5^Q@M7(/$ ^ɚ?dc3 &"209GD\'a_A߽ i 8\c)ɫdv  J(ЗV^ocOUQ23} ğc0TT[X'IlAh8<뿔nJ+fCa엝_!"!c xT _8@|Z@;QSgV$sdk|*+݂CGmxy S[nMW*B(͐xZt5i>]-.*[6Jϣ 0tdgf .eI&Iog/  k_/X]᪌91P18nC#ދglIv?w` ӆUQ˷qquTOAߦNpU@YȀ<"McK%d|[_hWR*Hl5Jw?N3Zl򠿫fz}E@z֠yA/%4đHLl3.}wIKV_4c)^v(r@ Y~ݢgdsS˨1ۥ"oqyqj5 Navz50:^),obH,,`VL\y^}cx("O  e=tm3q)ɲ{FV{ZJQI=%oNe\&&x xO>E_LAy6kX|r7.uٌUT~hJCB&}y+gB7O΄0ß#*c@u{ѩ6ҒhO<yTH ='A֞@^O:y?/r-fkaPL߬Gw|VQ_&t]q2A #AuBsWEatVUH< řpgChgANq3.BgV,ddH2#E)rR;ZrH_J4 K+ e\RZO42MOpt4чji#D5IMa5ls.U1Cu++e2 厶ZAx:a;-0[e AbLS\=Q e!6WF[rm"0Ӈ3 Std .• TIFbJ.g+͑G,0s/O;q; E;`UZ))`ED.f_٤rhJlGI6.m^VgQ7 qPI:κɀGOБ~!|x8OzY)&A{!%hS8>G:&SatnBO<̌o(_J]y3F{hHl1ȥ1})L$}&CI1Y=u5\K*_Fs?̦Nxn>y!3O;.>߾@t`J@tYׄT?D(\!jNmer QMu]cf< `7yT+*iO70,t;d@r(.r,U%9HH.Xz@a ci+ӭbhF01bR&qDK$bIXӷ&H2:&˃~wAjA'L_YlArf/[(L^[hE2R]x76{b"'EV1^o[{a"Ko h tbł_4,*4aħRɩ+E1w'g{+;ݞQz8wYa\J_&“y߶6C+2)M8t(EgX( )LryvZxdcPrK 9Klu9vRd?N7@ۻ@5Gqs͍ۭAa0 71{k,N[)^{T}K"JpeMK.`uNUOeYl{Qu^X=|7ЅDB, )Ŕ=&`&1Q8l쎂 aI-\ qR ,+Z13x^9@XM녏*TlRy)T7$t^*ن>ZXVzz~K(,c6kmz.Rvu0D\zW^xۨ,0bC!=zTrMT5 ;zֹ? 7ϏhY]brN*V悭TUv=$s65`>fNcuL?4'#T:Ө)D$ѡK"$c oeUN}&-yn2W-+ВЁ7 usMocIfKEK38?Աy/fD Q品bNN# 80$_EY^[+1/}u[PJTrZx6ݯIOd޽_ cu}F4Q4?@s"wYoE!FB&BR+D@u(ːd4#`x\bVQ}]B=7YRdO u|:fp yyN,'[8k7p;n3Whyc?W:}]-ҡe|[xB_ ?`YYqVA|*QUֺ.m*7-\sۑܬhn]:e 5Vvi9O(C.)-᠃ &O;On&0~ c5nN8YFI2붋j@f-e'j$>}I eppBFǸ/BBR<ȫS/knw^"hL>Łtxy 'Q`{XR֥A8'W'rvb HPTp𥦍U8;!,9eL娖oL9g<\$b-Kixpg9.#Ȝe7NABca6]ֽ^C-QB0D:,8`}X+ƒUZV9mmPώ=]9Arq(^X@zgO\$W(h+K$js}}wی~~ՇC'5y"ƹqcy,e-ʢ ƻYX]E|ݚs"NVZج$Z&GKR%9EƂ|? [n{\ d~TKVD"m&5y|H}{8sYI><ֱm>pRsb=u?EL=fIn3R PEZz'CXf?i8̷)È,V}/-] nkۓ$ox+^ F"˱8TIn!1X6dl6%)mUe#B"۴z朰o6B%-\=>)GQd&5C8-ŐAJpO zǕRo8mxc]kM?F kZeGjl‹dήdya:Q_O0zQDݻL8kL-:p@:RL]qƿ }24pVv3]OY:MKhteuQ)LM@a"1"d/PL7}44kuІ)O}~]Ky$S{=_\V*G'Ƕ c jx9@ّoYtI#,)c0i.g}H2V+*pߤi X*@`PS45 `aD dy[}R£6Ӎ~M2KyBt^ 8'ah,s8!?-V -Ⱥ6aSG3p욃@2~◾-\-Ϫ!B}34! z| NIt&^ծ+Ɋ[P9P`V䃂4'[[~_Q,Շ2"lBEhKR-죣X;9s)| JJƄѦ@Kl Q"ɺ9OVz+E klNbIp7T/N~qo/;u7[yv08> bZs24r}5F9 ia]Ž.Gp~7qx+0!mE@MK3T})Y}PT壻,yk-Vp( >+- Χ Aj_) $|"?;(}z Q"yI?m*7^o53%+ذ w:v80]o.O8CU G㍵CFaHvm;>RWГ~)U;QU?(8x~l;qsϝtHq'p!܇Y?_PlKA;T}22TۧSoC`_Z]93AK0BϴdL}RNĢt扏j\~caUՉ*&ڗ/u  `u lκX7K/5 K{T;fa <|2.))hTkeWݙges&es&-;xC=mY3y}gUXb`J\a^ jH, D۶ bd6Ѭ´^pJ(G/2CG!ѩmoUIXJ%| &bY0e躡's!eGkLC`޴ E^C7Iu"o:*ƒNeJS**~zqs%ɽ8[ 6X;hjIuDycS?R]ub{N02;*OHH#8ꛤ7o"*ùwJ,!dI,RC?1KԩB]DeV8w1T.2UX3yKŐ-jg)TLW!^LOܰ`MPOݞ!E!]vU+ڊ3fw!| LHbImB6bW`\Iړ3O4!h:wZ#oͧPK^H om8Rtrp :zV3F 8 qobpwZ(ECg!;VR d/#m m$4&4ewϖ%\ZiÈ>W<0o 2]YO3ZT6J;~]{T30 oT/dX}AȥY$\z+T *^AsoXRDFr;:Q$*.:w>Z@~(&S9 $$[3a6fm0b3nc fTzo^Ep@2VRn n1qL?УESK~ƖHhf3b޻s/ofǯ@k|: =oL\'/:KNLI*ǜK1zpKhd3_$֕UI'`/0ĄnW-*Qw7% gtQT]mҜX V9g?S5['Ѫ$8}\z0?eFL~̲9Ojr|y<W*$ɢSحto=_*iԻv;_㈾iv~i < ;o%Me/wQTbvv HIc=tجȲ'۰L=V6>6gd6 bz#a*ro g5O1]x^a~bOwgkc<ą%HMH>EkƞDY6ln>*c}(M%<؀d}mE[h&!:9Ggx/8qRGmJCa4teP 2 c0!͝#ԑtfUjk')ьƷy5x@v6]$Z Z>n`{U ?;1VY@Cxלr [qUiBҴzdBɑJRN~X蛄% m3jRVX'!yt [{)\cf~рqc2.QZmGO4=kݩa_R@9]K{yK1_~ZDlwm`TQAa~G d2mSqdg:;9crͻigPC0}]~tzrW~_4et~r+$8q *TsDT1O Hk([OSDۈd y̍mGRTJ`= v`2/2SK+Ƀ88gXƞ[OT*~D " e/yOqݿל[B= b?_'BZ {ݚՃahHG38`qi9`F ^ B*j˝cMT=.tRVH @/wZY*m$"? !ڐ,~`& j"/ y$\Cta_]n-T/~ uM16,C|V\?|6rʰ|JH+0ބ2\UCCvrªJsfw/K"G 9ww!M-"~HC\4vJH1|Ff?\󶓭GB/YA$8Ԝt5״0"ANzY7s{(@3N̦iՀwZ_~%zm%K*_qJ("69r0YY.ǔĤ%`?G]L,&W{M bfX@H 9Ƿ c#{ր3{+ۍ:HʦL7 LyF|~VsSr¿с9g>zs&2IHNaG9=׷ 5Nkr~+Gbr &|%j5ޙvrϚېp~f1<~xl φ6c8~4˟YB 2qYJf"&r{jfd2Zv4H/j eVS^t4'PVÉzEGn1泥m&5-[_ uqaɑzA2zC 5eS7!^J^4VC3w.I-+b lx;!Jd\ɏ #8KT )i-ZUU*$RWz3n4ux^UMLsZr⯎[is^r!*ߝ]IohkRPvvΦꏴSCf[ȼE*\qgO w 0 dZL|ɘxS k"E6Y|ѰpCDl&НI v>L͖ f)UJkx#J."ᬜɟy#;\7RrQ^6^D͛)Y"&Қh2zxL14+QMOR FO{p~˿9IqAr5 M]ŞwVBA׷ւ3of}$csWOW*xEA\@p}et;B5Aָ_a#bn AYvJp:a'k5Y4?S;GD66& 0} hIr@uHy#f e!gW'DsE:@JrSAUZ%fq<3d`RS.t̜#=tWkCytӦeF1?3Mc=PH8‘9ݕti;@ $)ժ  kCc YbH.;eT<@NتKƩ BqH)Cpy <= YvN}$XG/.2wR/=o!d@%$:^Im:mUy=7~Qe{ݍ ԶsNl)SE|ʫ /fq ?E%+ƞMD]sߓe} 9k쭝ZAa`='vhrmS*䂊;XX/'[x1Epc.xO+%[7Qn$`7riF[vz%۪zFnz6GsjNd14*z [rUlh^pPG"@r`@ B AuU"kK0wMjK~d)k@_N%kna4`yF/jN͐#g#mǠve.Nzỵqj>Yr۶* s>TǗem FVk@W3BJ^Ȃy{pHwPgC08١+3M]d\W JEaBIz;ul2%ĕ657&S|yk|玙'up8ڠ \AA2%Tj6JN.knnv|]FV#b o@ߵ4!u$1I gom<ı7k Jvq5"&->::R(׿KZkI[r} '9"& tqGG}@[id 32t냟4x4EU.2'|Ƹoz6{O瓳bFc'y 3fᾬ[ [͢[F\lmh{(\ l!}ͺd̺s0pԭ蚏ޗc G+*[ 5k$MbRo&xrA_߈FW914CABpq4f'7PKOi O+k[8 A`v  VYmKN)vY }&1|Oz pDd]1:HP3Ё[Dq tյ#1Mi,9zs=~X2Ь.}gްHYsSDŽG=W'o.ar1#s4c᡽mlsc܊!OP yHZHͺ>P3ɇuÞd~k`Uf:;wNGT>zlak!ažHb^0dueDA3кWJx& rȪH =[qvĴKي?*Rd}zBMk~5J%˂׌:g%`1>f߉)@% 0zIGвߘ: PTbHJ?f=vtXQ/cX@6U(p8Zj(SGYG0"ǛyR"/&H㎭hL U;Z:0H9BlB G1!EP+dCPne+i@33J=q>[R<0SKgaHgSI'}g+VcKEzLe@hwdd%>ɩ=?n7{T抉EM!T`} ?tEQf5%Q/Lh#7 Tit{S)R640 U>ZPEjYW6ׂJ }c t.+c70>]4eOoDh`ȏFߖض|h oeûFTւE m=(0vrw=/~dpL|;"Z?Ŋ^1 YEa5 $Ksy;BύJ(Fq8tWsR 'd{H9oFգ5>wm#VU;)zU6z ?H=]K^|Ge*{EEnbA?C+Er[=>c? Sd.<+b >PO@ޤ ;|:Y6~ F֑#Y|:(N͋yO-'dtXSi^%l[:'].si%Š80>d7pUmb|,`wVR$NwaѸQҒ(@8F,]_'/4BU m⥆jSK$ZgɶEXb\ڧ$ni!%Cs_ q<|B* ^oX>4pCd<=6NWY\01G^|l_#PEuNթO^DN 4#ƢQ*ZE:~WixfVҒMFbw]wbQRT@gt]=+&]>E'4zuSb(izP$K ݢI[T;%BdMC^z+zeSHLGi#S^YR 8r:VM<MG:Bb0P pUY~lN $t#iUǼP#[XLZ]s2j "hom5*.M>2zo,$5:OEh!EGIJ]UǨޚcaR־elZcHGM ay ^8AAr{k@F ̔n<("F^ MAeL?Ą0J3&q)}BͰ{hd3yAѐNԹsX,qE:#(Mj[˓\%s^SLNmY`x.8ѾXmdZ>u^Ӕ×.>O|Aｎx(>  k'z Vx62 khmJZr. @R0C,o8P {{ȧ900brJ>b{Cg9b﨔ɺA< EVmhVhƇډMϺLmzVq7);SLD֐vHEWuW|m@ʓ{0"ڻh&/[Rb#uǯz \g3nj o8d`?7m(B 棄;+YtĚhgL9;05Md 4_ V. `n1St2eFO,ȆKvOfm nN5# (P3cS//JVZ/b K@81iTM)J*`rhٙqϘCk3&ٰ$E7bNX!_'pr?¸ga㬟KŸƖ.9_})OHBUsr?'t hs1'b.+KWqzUM,S8<2Mя CCmZMsK+Þll v[F؏A y:ᚧK&St3sXA2~Ύ nO%Ha'C}9E0do7}Nb),q^jQpZ\-)$dV;+6=OSciw ^EAzf"Ml ulkٱZmv#[j/pHW |%tGzPcrO`Adn`<Ծ<\mƢCwc{4nx&N> >XS&p)U5hIo8UnTip km Oh|6*=]o, AEDLC<,i;]Hʇ p)A8n0a~IK} k+[‰ϣ?I-XmAX_ ܝBԽV̂(w ɗ!(LYFŋ֊4Ԣ1l;ԅsŶVO<ר0`g<ĉ[Ps2)enu=] iB^Vl/5㣩asTm_^n6A\v0W{~rcD. ױ0/׮<( Mc ھ< _<a\ɓh'JE0 "ƈ ΁fi"~V."JxX*,=GH/@zT\-J6t -Ц|\r$xjHlH  'd?۬i@mqa3MiA_횥 |duֵ4pS`g6 չ~cNAC,RMQνґ#3®S)=_/XU]v)=)6v<-7ԄdIsdnoN(v>>YwdB0̤S G9IHƁw;&o iQ;v-+d^-h' OkبTD|x+b:/Uqdϭ+o؜ӳ=IUcM.$4@rrR >Y.om˷ &ziG3Zk/EJ&zړ,qsB ]Q.V Lƫ%Gݴh&; qXEA5se3=2rr)=dI~UO8|wٓ(ɴb~إW[~6@ *9t zQ>7E֚47 [ų @5L-n-J)[B<>g+ob#vʲUf'O1T+e))^2.6!U]+C}O7-'2 Lm Wb !|2ں!] {ЫS)Wq??d+˷}),+4O5aJPFzSZJ CzYQ8~ws-@'{ó:O6"wUhq|ʡHRƒڶA )jfBXS _>ChY+ڜm2~\pJɖ\X@$IRe63{]FHHRl}C2h1F`; $:䚺% 4߅iѣaAZV~tpV o}͐mʢ;sWCg'wx& Ҡ׭Urw`9<( O'o/gAquIW% `|Ń?^cr1݉YleOTu&Ao^~k&oKiuf)B\܉\AY)He;x3CsIx3pҗfH8V`!+m;3**zX@S:"t<Ҩp| Y}![ V3 9w82e5Wxj+A%clZK#ug<"QCU!.4QWKMJ;HeœnɗFyp$M }O ɪLNQw591.'j+jT^+4Rzo$F`8ϸ -SЮ 25od@*٢r9b^Bum d kF/ nSӷ"HRpǵ0%ihcRć/w&V)_Vm~;a>ݐ:Kܠ ;xDyXFn:luԾqxxKa`7؎3l!A=r'|D)r&ICa8;uMcZ"dEv_S:מUE хZ3Vw ^6C$-_O|&q-^p3XaWDK 3˕, ~<)6Iaiy0֥Y=lWn]2Wd.:tvU;p|>{ߐ< 85 xoLZ9Zt^H "]Uf$O+@ +ebV ?1d ZnLS҄XQC{CC=ۿu4ުi}%!%31٠Ll"KH2Чk֐JBbK'CQP.`i% aAZw&%'ħZV[1:iSƓR;[5oۗDr3n%lM7]6Yai!/?/QaJ.&~q|-d`$Ai5nT[k _0O g;8$zBlM 3TiC;w QtƲ-rؠ-[oRq"TH,tPSP8aջk! h|fyd ])7h"vܠo˳\ .Yg]`4 ZA.|ўt-g 9 A m/vOmvuԥ^#^kmUJ[hҗC$&=f?h:e 0(s)>UO{~9:++й۪pX¶N8V1Lь,s31\L&%ÜX}VsdPy.GHV G3Ozq5QM8 vb1m˻fû8$殺S]}|^x^1FāNaҐ =#GTrr1FckDPsӺU WޡHOpcW2yG<>_o++KH[v] p|kХAQ?E(5FoF6|əvߤTj)yytzIxEAt\E s*uںE`e="Wdg29+{|UZۅ zVHRF27Mv`4a\,]F)2Zkfc!X`@D65L~2Tda-! q2)5RcrsqZJlxDpL 9J)(rr'hӨAw =Å,\Im@'Jbm|`s~˖ϲ \;oFBB.gutxŕ&revl3(6-G~!0c47QL{>b(b)+|^9W(m.Kf^P|{]}ety$1 w% ).AbڇL63?[٦I:&Cz[d2>+Ld $Rj~8ܙL@4^\+Bbt3" 2*}KތHNVq`9X ދZ2ѣ ~F6PM̻5jw82Wt2dߡ MBO]7ʊ :&vpŻ點޴+`qp.>YK/XR0,V;4ΤRp(+TZa.Z^(Ф2Xeo+]7޳agTxEO{I ҲGZ:)՘gVj÷RfI}(Pt6sx2%z&O9R$U&>z0Awv0:&=+3Mc9iey}SjVWRhkB'!]"ORT|&9ˊJ\ yHawPV7͘mӨE[|gCщ_ K$mL͂%ۖp;Cr=]3/EN`-"$1ch"'ow׊~HVþ8U(w"nM+ BxK/蜴IdDYV{{*ӫ$܁ 뮇V`4> Rc[Ϫ#CM5=S'͆qhsd6 =Ai3ÌdK(kzbJ2FC0k j(8v=pM=$B]1i( b߉s". 0xwVs+auY&6E%ïc?*Wt eAoiF a ), w3s;^R|k)vI7tEQFU) ŋh+^r^+MAbn^uww_az^T$l183fՍwk;;>D\\} }PNi!l&Dp+w~/r2,6ޑ:>5Ҩ?Xcϻ)Lg:-إnX1N0^9k0;eIә|m&:wV!ߵ/`6q_>b/'g `nm@MNO`3zO6 ݣ'ϙSIl)?\ ۩DUGj.cXp*i0ZE(\qoQX A}\|dxVW*B`GmNZqA&,=G!qi#ӈ ]% '(~h 0DFaouWbb]KtHqRk^WůRp6 64Ccrn 韃e`! j. g1O_t[uCuԓڿ'[E' q KΞmL+gq_#rbղ4 N;D̄Cؐ6Pm]OC) 3dAx` )#_Ue+ qSAzΉ\zCÔmL pUlbdNuws~ -%[vEFFu3jv>էU`ՌO8r A{;[?VRZ!~K<=0蚧o;<[!~<^gC(nNܨ=-:QH腛#s ) tCWܴ-">IKkGPgP+7`I6 /W#0Qilm90x#m!v%%)F Q4% h`6-4 HwZ_yGKCQ z%ʁ|9bvy5iq}!r@1:QN1@TL˓:A{嘓|G8GtQR1\>R>]c'++;[ Y$YнLr?rLpVӮ7ګR]MBZ=/(?#EHK{~1>0(VP l쟼~O)A +_(4hBk>ο9whbw)$O5!M|Pk]4F29}`PvqND.CL"HyFC F3_䕉0ݣ_'"ݧN8:ULtK#﷙sΊ-7UrҢ& vVQFDw=Eћl/>`A )YDZ8VG_W"7@fӊ0rOEIB {>UR='Q5yukF>Gp (F$y l er6 XZ*1l-&@%Pm9`f">4xBrh"K P()a=I*WLv5BLrniz 1 Xf%Ldj[i~*=d хN5ݡ*T™p _=ō-.WASl7FEƍCs#C$:`k u:]!qUz/#+fE\pI9@<|u"F`m߈LV Y|6E8C2L\pXӋ/q')T$tkn~ZKT,Ӿ޸oE-ZaH%ɣk,x^wZHc,D)l0ė{u-zًE,\f bɛ:\0(SǬ4bw'$aE)tں,&*]sAXI^5 )V+?9]!%X?;WQU@-7|VwF?u^_ֱu!gBrH,"ikrX}+mEchx{vYZ3 ?5}vLq rR;bci7-1#11 Ŀ^= ͭv˯{>M#^ՑI\| Sz4뭨cdk唠Z KbGz{<]o͛;0p}$ʊÓC7VdgϕNK ] .G>Z!oPTuLxqJn%Pℓ> S@jRxŦe+C} E xk5M@1ߐHUIvHW*QcbaIE@l` gi;Zѯm m bʓۂo 4(Ϣb/zŤMMUf֨2eTUEe̾KrԠJY CU-p.<ϒ@YimI & =E wnfJUQiL]imjHyA%E7"g =ҳ@ *bs-㹃sre>xd.2c"72FM3ځi=!1$iǵ,o@V#_ox}'Iqq=߈1ࣿ@0 n3E='(i(CN  i:kIa1ڈu P mVLd^;e]8{=5YL1f -g>9MQZ-ï4!=4eHx_( sNgH M2ukܶGXAۏB QҘr I#XX(Vw ޝ og- Ncܯ&?HF} +lJ u!{MkP{%Ȇ׋_g`—lP r0i HuE:gS~NJ VtvcKYޜ&8Y)VL#LiKɇ@+T<C4IOqPBHKN/~e!ZDVY:e#$,FV hEV ߽ZҾ6x{q슖39zK~#2|[.e?%ګdQos-(hlj+ڱ>RfDAkϗ=o224ީmDA~yς!ܺL] גu|gL3:@z%3qO큸xg}A܎ؘ̎>"uIZEڞ# ܼ'*T:,Q;dX{HFvQnfxH daCb _:hL^ws>i*svֽʏ//-U L =49z z`dj9(Ws"շt>lG>H הFww 2*<KK& rU1RUP{?0r5JX$uYM39wo!QѪ}ڤThz6#(L䧗#w6E\"XjyhÓErksvp brS>dc %.=er#Q}^p.!s @-JYdqaa5vÈOTwkeX=UIy<"ymk "HqvPdžZ616Mg⋻U~ʭwjG @M\vK3깿r7̹bg~'bJo,uO!}&Hq6c~}hO.ya-/D3= N%^," QM oпx!o1J~+ufvB]Mi(%4~PS[wmu3 {BIgVJ=Ҷѳ2 kxWЭncQ7VF֧[36U#uSRH0i~7a #0|y t9($W= @&.?Ik Rz2탶[e8Ys'w^d*k }f5Ԭ&AݱxDfk ɴ1d63Ĭ쨊AU<dY,*V0\ˑ0D3IS'm7e*GV[z{K)yn͛?ecF{;@L0x D4i$ss\re*p:@CHϰ篒xUHvҗq@</63{LZ=$77/{R{*!H %Jޤ<([l~m R~Fm瀣e(gt{me_#tsEv^$0FbiM2voxk ZU ehg(=%u|5۔ F8]%5ɔEKVBtUqB]+<Lw]P"iȑC@@ ݟZf]3hN<|'kuDhv@VacZu~&J[^狯Hz(f$%EY*b/4քkmqa`$4 ]l5ZCBjh'kD#fyҾ)0jeXY+-e! o5#$J5v*a0C *Lt9 x jh4A8öO; ((/xJO=j뉞MYB{ǷW!3Y;g(kd6-,$kQG8bm0g+?"PS_!i*g{)vkN {9SIV4;)Oꧼ/~bT[GU0!&Vb:]>ƽ  tyvKk5ӈz,;R1؃ -YpwWF 1BT_kԿR"Z˕H\9Ѫٱw{_\ H k%ʎ]^Ӧ9g$ű}-Z?a?<;]+޻L#!e={Ɨ鼡H?nGhKƅ hIdV  %VI2{\I"|zK#]xv%qR& _(*S$/NE˚+ $ҍ5CBfhV(R'.KsJDcmEw.`ZtTpu@OfbjU4-Xљ8.s8oOxsG⯷v֐zy2FVRԆ뤀fitЕF*Eԫzym=WrIohM KT,xky:& "5H{֍qar7m/nHo9܊胺Cuo[>S ` $TR˟b"ZQ&\wR7MRB6[R䇿mV}Qw'I{V::@Nnyڒd-e LK ?8 dmw]]s«JZ.sIӉ%jxyr.3 xԳmEΌ59K QTsbgH(DJft5>zf( rHrLf f- oNeد$T}xTJdQYϩZmr#&eNR;Ӡ\kiSgT3'ʑ:JzM`db'mys})ԾҶ>dV$],H ,0&h)7N(8֨MߠtaP˫QRcڂ2}q4!`]d ۈ? OBo[Pw6wq@Hs Eb1@[,(c}V䪻?w歑2fl&XQpe܃ %3*oзTW(N<3&[]meVӿC ?n"dlv*$\P4߹SEuLzgLoBS aMD|`kW`ҎMX#=sQ5uXo4F.ԇWͦ+x`H;W'* ֬5޺+#"X*K\\<o8g+Z!FVZꐺ˶ɮ5Gmcp}9ަkCflD`R}8ojC@:/fj:U i"Тۖ@قd8?>ߐ`mX4q+4hwig1+8b_ =+c<: v(=ʚE Ѳdw~9!O|v&hrHX n]?ˆG+\Zg{)X}#٫$Bnc%HW'-̨9~LHχ.kQZBo+nI70_$EP:y$G!{Vڢ|& 'H#g+EP`%23 3&2w<}㗵639Swb(5"29D^ ެܹZڷY}!*JUʹB[7˒B0{vė 8?G(l{qղ/t'w+~q,!i))ڈ`/0@鷨y;Zc~a)}$7ҿz@}C6Q6c 7;u6x5OJ. 'Yӂ"BC}7Oקl2Ť^Z 4$/.BylȏupV MB ] :rF9gRTOO*i)ռ('-bNwi37)1 洼Yl̉KTUȌMfI6i!>W,AL d3e8&ɈU'/Ffnse Q^⣏pWbDF2rVӢ7,f_ys7 C)ޝluۆ@1Cڝ+;wcw?p()7A]w[$qkdN~ICWd/B䕵:dm/,zpv\u$";y9w;+Ӈ|+Ir3|;CX/!2BF9xM]% 'KaN Ktم/ĖH3|R~͎5}a 3VWt_WEܴC̊/SEu{Rus-6x}I<hsi廜stͦ9>ۓvX*/Ep^h6[ |tlj+6B`S.)PfHl}9g򝣘݂Slަ9Uŏuo0)Rq *fm#>jj3n5$ӕN 7хc|iI̹03K|Nٶ8kk&DNxs9U- @3 IVPg-q3t䷟[eeљZ޽QʹC4RHEytWMZ Fpk r?ꊫi@;Sd [ܧ-:)S혖WC7o(2`صnVZ.`N&135Ŏо\G V;O[ c1= cԦvnCD픥ԏ`tgbw}YrK3IMӟ'ے訧 ^S6^9]*CYÜt%+^9Ξ% X ӟyT_E|SԈ5R(zg;JW3dզA;T #$5֠(0 2h!4ΉYj-FRL߼)1wchh+?]# vHuJo9krI.nmn* O7+~}Q =uO(g ?Nv\u|6G?c`euH}DŽ [dtJvXfL ohN>йUGʀ]p!6Gy*a*XEGVU}sͼ8rڣt?TcTݪ˵{Xg)惄Ҷi\6o5jj `2yTF߶ֺ>sYnS {j kzP^4wNRy .㚊8_h.fAeFp"Ld&lȠq.,O6FÐAgsov8|0E #OAC^ai#"2tת—+ b`)l%9`'h + ϖVo`2$0Sm [T [MG1ֵxյX~ A'yN V]fh x{44WTX&{c "9gصZ;'ˍSd0k\^ Usf&w{sqE^mPҿi:Q1;UZaŎUT.U]1wbd'Ph)è 䐈CһIw8"6EsG 4VMp.I͠gr昬sa0( 2&~M[=0(jdc7M{Ⱥ@)V4b?`EsIz澊5(1_^9\~{;kh7K@09;S٢c@/?dZFXAoy5 F>_pt"wS4~@ ɺ Es ԭ JrL}"|yU )&^R 5q\*R FZ&U?7=є ]w#ifQWVvx~ Roj3hUHٗ,C<-UgL;OE[m|MLe97g%{Mm"ÿT@5.OW=+ 0U2W2$iL;Z,@f9>ZlГYH% +AYRuo |[-pGt c⎭pt1S#r~J44L>'cȲ Y.e4H*Lӽc56 8uJ~׈o|͐8?h@eH=Sa,nZ+Mb[=kwʀ%iH5BLVY950;0Fk|u> PDԤ*: y'UF PLŎ—HGW0uP ~1Fb3LJ"X3oHR9(t|ٞ5y u <+QWR,c?8ZgĬտ'iEASò7u]9dݎD9@αf1@^xr:1J~ =Wq =`","V;Xa^5wcA!7σ<Ǖz(FWc?pqq7b"ޘ?7kJ(͞inLåm&ry\͒cQdHgP^_za ]^1˵S-f`wr`G|X@Br 5`Dѯ,B.6xiXNwǿi9Y07[v#':Acm\F"=3)$= - FaR'١{7k6ڛ^8j_GnHBRŠg}I{LdꂺOD++j!I;|m\,SɾQVĄ=A]jqHvF,5.si ޟTyyHܶ>w\ V<8ƒoY۬#iؗeΦdQSG "3gsP/PJUq$!缀g>װOW[2".sVjx]~ʬHrjo]K?D[cDN.5TWGP&@]ˢW,&(Kmzvڪq[Eno:Q}:Au%|ۻDTHNsݳOzUg,,Z_g!:-d\;1ft‐O7nH˾.BOc*I~K`d7SPzB2>/Y䦾<3m ЌG$l2GdpOm )urh|mHeMEMCeR]&=UCC͆}f&~5.Sj.(X|!;NZasߩu.=7U<LS>{A>ʝ=qHp*?[1r{S6]vx7( / /F]GbBn\/BB:Ē3E N/qlQӶ$o\RI0AW;|))ZlLw,hjm@ Zu &e7.n20~UHu[hѩs GT.]^rZ 嚦Pab,SH6Ԧ즈a>>+5yIjZ`fidIXQlgԁ.ŴxζP;ICԚ`X˹e]LilK um¼$^+Ay5IT*C+iIikS'c(rFB&,1pIlBp 𢾰:'мۮ5Jj9jUZmEv1ys`JZ֑k?2(z`b<10Cm("И_YLwtčRL`4ㇱ!ҭX24GK="5kFӎ_7i _0HlҎsR>>˭ؿxYOO/R ёrӗ bX ~J>z*$vk`Fq5UK٨%4'Zh |g,0W0; ^A3t}4eS$Ԓo zEÌY+&n[gDA;-+HW!wZzGT)0DpՈ($57M4n-av 1f{4*rH|aL- йNHzlY}3nN+AzMQZr7km0! KW P+ Xw:{̰@&|ÆpX&b`FPRk2iVj  629u_#"H]yc(CĚ.>! ,m|T48nk&|h_R_ kUz%6c`q4mRmvH}rXN9h$6ZWUL~Ub$v`_VсGI܂Bf[9+>&)ZaΧM/D( ~Xńxp}bI7osOt_EFz(M汄ˆ@Ư>9Y/WQ9oačf*PzOy'_w-~R{& >cMAi|AcLĒIR9*;(19{1Z_byq( |I o*H?g_nv]WL u/~mRU Z3<\VMk*ipy-axBR~$V HKXY3w!'d*tß0v-?u=/_ڹ}EӜe-X OT}(:cx5{11v8gJFUx#H9ZkM~xԦ \'5& GGUk dX[2lre"E#8\d'Bԯ6 2 (jȭ0^ȥU+dvSpgFa5tS DkaޝDN;E鵠D|ReM/Z*lliƎS%#273DAJ^>`eKT|x ~(Z0Ph+ab M/Urx@C[9$C{H#.HU:&4dvV6M6!uK!ZFs:AL^Sh7sKqe0?/hf*[xp3~0`yJ }C천ҰZtf$gt\W6M1v?fXjSԜVy%s\HSH8Y 3Vk)ضW 1RrN&M_&%V\L'2٬:/(}uuG}."EPDZex.;W/0Y&(tAX,fLYŰ/(2' L +2(z3(^#m2~cWئQpb\2H46+#NC@kZB=|kւ(Gرd8t7y*8e{+܈@-u~lk?L&qrўQ Xb߶ *p~g8[?0pճ~CL%[YgnuUt1oȒ1ʎLT=ۼTyQˠ|'3`2`Qa%g,˿3‡-k_LjX4*Û&_~ 5v#TY=U q"Je!*/cSUNa,5/ $]gSXg 귅nn&z@K[G1gD'QayeaS>!~ʎL\-hW.lݠ\ѼcM\:~{ٱ5ʀ[i[BGT\=\j0>U(k ai*cE!I (3}~2 zUR>+럁|`1Hc* U- AKOƛ/Cp0xwwS09)ױx `h&r{ iտ]jK)ǨxFF v\# l3+3>w} 0g*vcmlA ,snmL >"Ԥ6B^1yZ!﫡 ბ U{SkFˆEKY@\/ P3ݱ*erFw@?̛NRk}H.˺{F5.fmN{" D{Fl%y_–U!O.q"@oX(WmO#q`Z-ݘɈ67 qω).UG$X tvAeWV= ?rZwS?ǁb ey.a ЕSdngA[q]5e?7Y ݋g2,dSp׃a4lITͷ5M5r%1yMv{7 nw@ɒU%CPNk/KYl?y+=oo:V& X5e_YФ9?g)'M ϜSM< i4kkDs,ߧx Ut(4Tz.-cr74T?`jC r E߯E*CG.$o`KYls&Bu_EWb=JvˎFt zc`؝Mٶ! i,~w4+YڧV V9onU -Ag\,]q2Yy^r8GB˾`)U cPqr2PjkBUϬ{$lW@, d+ltR4!^[X})3um@̅2ƶga} C4n6#]1[I^]A.L1t揩/?(#"()9 * e;)r5`,8r |z358. mzmuW-bmW L4 hH@$sw57nGdYܸԗ FfлKl_c:poغ9@),yVl>I9-99I{jC!Y~ IkM Ju58a=BvCrXVxX-,Nf:G}${.bPJwQ#t8 O κ&v*.~&65zRh!2Hg0nʬD&j&/S9w P[MIS3j?6 `x*cix#{gXWr|=칅*DǯenRpƟsbWk! x *)fU'Ёm ݣOzH?wφ{\EbCr6Ӥ |鍤3G~"&.AuY81?NvYЭ/<ſѪH p`'!͌2} cd 뿪Dq`E](a8X[kB"}VK#j9Y'EbfkC&HIp_Y.5Er<yⱥ-L2(Q6LxG*ΐň,YiEI`&*2u{Clgvdqb^n]aVE|{ ofҕ mvCr{(] wweɱ6y)NLV\]~, )B;؈ւڨb X[?=Qq$%W!ߊL@\!q}XZD&%CTe1JW;n 'b\rz`P ikM"ň-@E&ǫdck,VcؘfBihM@ԅD?k?GkcC;japO寔 ȈuCZNZWw6 A1s[o0K{y]@ND *X1迏8-UQ +{j_;48z?lMKP}z;R;""_y]x\$. -4Ks+0C] !ŅZ' ~xoBt*勋ti{>> KK!”_b# Ww%Dz]I`GӸޑl"%{ZdzP%[7Q=[GkQUmGP'ͰV7 ,.H_6;b+B-f 0x')ZtĢ8^ά>Z2 }@[Lr^*9} X6E Uא{1a5=vY B-Zmp N_jVۼ@ gNiV0svJr" $W{m_$@5 f.[]ʔB`+RqcԍS? LZr3Tq>g\'q;X @$$eRH*Oi)Ns2iS<\"WUOPbn S<%8aP}EMXTqɰZ)ڋk?)^5ǂ ݕ#B~ WE7#O*/MB"Ix I|l5>a_H4~c<.yսU o/Ġ]=K),!}4j9`Jq6teM\J .p7DM<)Oj;2nty (3`̿qSt$TΆ#BhQ;e~؞O!s ',(y~f X#}U~v2B!W'7; ܋M/e)[փf8f6(G DStw&֧;{3T)-FN[\!qK$rE\yi8JOO[ ݇HC&އ"9\%`g^;8@Ǥ p߲Ġ/TN@+Pnf91"e&Ҧ+6I7qU`2ͬ1L˅s,nk ,J@{ġ(WSOkK,X !H {6=;W=|IBsqe\YөϘM8r5j òimI_1UHU!`X:-v쉵5*rBK=S&;c(@l.%]ɝjJʡ^=p~7\*s6]ZeZ/0%pn3cXY2>Eu1z7;W\xݩj 嬔]t7}P5I҆#3OyϡH[> ?'AZ1Ԫ~e? rz6"YY07I{zR}17t38H71Hͬ0Ssu+D}2]fmԙQx MYp; cM5q2&Mmm|)k3P21Qߙҹ>:Mn^&szTd!Ȟ1M@o t0 'e%EBԸY}N%&hO) dRlPSՍ,&hׄUidd\5i z=i zN#Cb\vGzE{bIPI{O޶岈&Zoknl0DgB*Zbo>Xkg+7'9QOE9:$T,V*mMMt` o6u19c!cIY&5rE794%CnM~A{þ Xz]| ?7k>fm̱׹Q )Ń1ۘw\l^kNѷh1UWrj@ ].$jT ߢf'aɝ*EQoFAnf͠$6D͑:%g`;QIF)\YY&x d%G#?taQ x3_̱!%uAF[g XAT|dLnضg - jOR 2qj=-QrBNOY?6 E/&2*(y-*o]i锐ÅCkn0je!Ǹʆ-Hx= B\W¾DoU-hEM',#YbsY 3PNтFLpu4gk3/@!j-UٞJh>;1RsC#L  b1r/7 uW_0H(Q(|[WIQUƌ=d--HPJf {@ 9O fGY@._%€*%kH.Įe݄ PWShcL`Ul-8U^WU?RV&x9{3eiř7Aוb9< B&ӣwR+s do:ԘͷDL~W}xPnBv5Rf1%rc!شGm j7ץ${MrŨNUΡ 8]? fOv 9fM)Frp4J]Aj$6 Tq pS\q&NL{Dg@Ϛefs=\4SIldEcs8."6B'UT+}I9ȴ΀U|6 @Za3&0 ye4 &Z yg =:6,Whs1U7~tV>wN/0;55":݈w9Ø,m5]b7g=w3! )8%qi:li#@^} ftXgAް?ڹLhܷ1#s ^Z5/Xp{(KVƺ)cN>g`<-kᓇc]eK;l? e`U!28iӂy.*k zCra,_vTV48Ulju4`MlF'L}'wJkOxv Ĉr8,2`'H*-q) lK Nog@sYCU pSafox)06ૃzZx8"iN!&rC63.*A<*ݷ%tk~~]i"I{?@2Nvq^{.胻zϦ+SBw_=aLՎ7|SFq $%n5qxVib}A#yi_ $$" ȕJtuK-@9#^额?cu=T= sz3-7{aсuRH"dCcZuz8.1 'HJփHVjw&+& 1Ap:;yˏ֭i0lI4,t7x53yVvCԗFs;Isn gD9puveH q^،gi(JI}T&c3NL &,Qȭ6*]]3gk o.+Y #Jk}Z.qDV,C`[cTsV~nw @A\ha4% VL/T]|x۲͈ GSK6{f%ZKY٫1vT sԉ[Fae`MH*$$YJ, A##.BIBDh@Q<͟;4Ew*L۹Hꖓ s$0zzo}4z=l)vbkN>'XpB.mȚ!6rYkSDƱQdAA0m6gYy' +4cȑj~[UZ/b# P!rg՗9Vkp.;S/,I̢nkbC ˵yͱ.=>c WTr\P67X3VʾHJ=6#\C۲8B}4v.uT'')28#dz`m@L2U{f,0-绦mknB y .;YF@Je-^]Nsm`!S%4ߘ E;EQnUev|XL >mQOt ^ Dj {"J5qוT֐}xSx';y~Y7 72e҂^1.!uGŻerg3ܒtZ8-|f2O.ց/>q?J #OjE{Tyi!. V KW_kRtlڣ]>MGúur3"hZri)[Sc˄3B^&?86+qokDubMO v^@M+oKrqCZ천6 Sem.WJt = :g*$GJIԺW(ا9dŔHrvBthQ1G^蔡._]:"vO2f$۰N" ":>2Ë?uZ,q$ƪ?'xd}#Yk*pl#*YB*<ڭ~ JL(艠F 5BNd]P3ye74'c wIg>,7 @NjҤN) N.g'$w0nLI*#AIUY;jtN = U77{,c훢XsTW1PғR9 ưݗg$'>}`'rMNȋp#`ЗsR{H4~Ȯe੔OSgİ]ղHߌzb:-‰By&vf%S%M街sMr=<, B 8 <)]suu-?{ڃu`oSB{d4 lA 4mr]bwRԉ`Y-@X ѣ9)NIxpᐖ#䁊k{V)fd󍼎EK5>bGv켳|AR -- K bW0Rٝ)ԯj*^B,F (ryU<9oJm$ \H/.] d~I{h&#c֥=\QRy$=sk<5gQ_(*J? Q}$- קoHBGzII/f*P|kFֹ謒bA_+^bhuw(\d5MU(רsfBT\8ofur\bq_7-i.ϸIRey$n3M_$<o 3+rH~I]eٳi>}cuYXBx E ,\?o_҆(@zj6 #DT|HLOT|ŽZStwNjeoxσ9TO6؅\b&/-JW95 ?M7Ep Tf`OO@^)DWD_kʕǣt=JpzZaC@dFNgU#%7g;H*oʦ/ cwB2cuV#EƳa߭b?/@x勰b2ϝrr4c#Ud7@#s nJO+{-W<`DR.aA$@8e׆q@[`FD;x3EkyXkGw* w@-rQ!mTe!M;өC@bwݽ\l ]b?+j!3mpULz+q2hӆ$C[^uDvFHTj!CoA=r!.GleKNJCaȊ!ƂƢk.H,-T/G1efZjkn*yr\̵0lF~BRY3ͅ’錙}ڬf.Q^m>xJC~%#+Y\joTfO TlUPy}(Kƒ%bdZl ZVe;b*Mdm Φ-yncRⲎ׽or$X_R.s\ݙKQ?8Wz}Vb'ŅCSA#(ȁ6VֆEi\+YrvB%3=ej~02+c'2 U{xhKVڟ)'m.dƤ P -`6P5$RG<)?vOPaM !e腍2-HъN]r~VHŠh۶+@u؄+y:J4?z1}]p3$*w/d -] }j@d,3] z)UGo&'*wkk0Jp%>H%< ꔵnhƹܪ_ׄsV|ۭf8-<BDB1n8ƞ aFU_N$o‡XF9Î+ƖM9BC?.{|LI[85)d(J>SL6R[AUxX,@>GD_}2)mdh@eTG?W2O`#o|tXШJN:;-dV Ț d Q&ג`.lFd"ΆA]7/]w٩N+zFhmѓEh<]Mo :#ҍ|;W]=G̦Yyi SF-J7Cdt=jiҔ[!ӒFY\rs)9%I{i[vCxH֧mO(Ѕ:F711X5=l)w6 0P$jxXݾ DN.?REE87t U&(9qh2S ‰P}ڎ.HXoA{L.PiνzFI78a2|{Hz:xv#/Tb82EX͵S {rnDbp*-% a~IPIn$d`B:YeL չ 'mJ~Vز^Y~;<)6_jZ{(& >%qh R9IS 6N%eMk¸k`.uqUsQԤ#~7gU7?k˅&z3c{$&G>Fci`F5⧠L&tlZ5Wg+-~V^0oF:xB F`cpG8 Ohڨš(_gKe$ V߶ﺃJpx4$V?2Q]zg9_b#I!@w_]apq.Zfvd.\(|؆6ZjE`Td@jCQ; 1{g; ݕa;}̀G'I9`04["|!筙 ZǞ sLD3x ;kdv=&[19M}*R ¼Zۢ6[k NtU =3lICk?X0 {jpZ67f{Zwv" 襏e!'d]Ṙ|}K,$K?ͱv8 _48:\ %&#S#oZ-L{d1׸!U}݄NxkR3|}myD%*;hTt:qX 4|=0,6Έ &jU2 *Ǐmn*T`Doi@Ӥ)5ېGH`ў0UµԪ;n>D@oEÛVq59'+Vyې=߁dMyo{z ꥱI0仚 $ ?ڒeVJ"(d nn3h"JN8]pڿ?.{tcsL86t1ʓt;TYCi/YWy;F7MfNj/{0f=ƿ][{WrVXRz pl^|F̜"ʚt&VR3rropVse(. A1v \ .0]\o3g%06'ߐ < BD[Ō:z%ѣ[#('ֽ$9iњDyΞvұY@3ib@*:cU8Bx+]s-?Mt|W Ct>Iad| ]q NgJs[K%(2 2/ˋRo? bPқk\~;o oC`gQ=Ikue39{OVizڧMų)Oo0E#ɳj_CG=Ґ MD?JR:c^l~mPBvT]zu,.y!UI#dryk6,]G=+.<9JRFj"[Zž6i[XdrF==H .oTN%^^->_Lԛ 䏑mNILև:J,>oj$Q(YJd~:¬?ίfy5 Ơ$P$y\Y6QyVCyEYMGGyT#x.UR C#n#{ )Jy*0ׄ@˲J%װÂZu$vpHp!8ծ+PV5CU|pFB#8r"^Q l\fn->4 #h"D&:Yi9 njDl{YGT0-.&`i חlgllÑ[t 8$jfW]X9ftl=vuY)Zo;%IdхG>V~@ g(/C?LQNRv+\#AR'D#_lUhλ^kq '0j\틸6?`+XnpYxO@X*Cs(63qϰԩ_kU$'+p_[тbgq͞{_շ6.].}(t^(4ɠP/4 {Ɋg.z|D=KB>k{N 鑿B/6Q=,h ~[ Rݐx5G̛0KH z ) h5~ J6bGwON?peShoаx4-(F%APD(V͉NCza1ct0`u3ehón} @2ӝ U$:Edž:iy+8~'~n⩠ G9:PT`kle}]/(r{p @rzرBaX}Քe!k};=%„Ԃa޷=T;L򷴵CvI7dkG;K˝YR,Ԏܕ jGM\E(GBHi2Jh0.`OqveN:)(ʶI'Rd U D9a&]{?24TrJHvAc(Ѳo݇C[AKJa}b\[5ݏҪ,ɼ[U7^jհ?QK8 QǷ6lP޲m0%g KbSd[8,VK$ƠDpԜlλtkJgZ4"J7N;BVhrf/z^%vcI+-Aȅժ h`+|?=ivyW*@ hi>}>Z҇ yPWR>;}L͆6۫ xÕײamXYZ|q5hHe@jcTT3R!2u g_- 3t7 +u;h4/^{ф\Pۭ;Y‰`> o ˧h^ $R00KQn*z):Cifgw1XdH>YFtu!h>=f1nU3Kа$v-gmk V(8}a՘ +x}fžmRWXsnnVdKPbg 0՗* !BO7Ț='ݙ O.V~cgq=!z-hH1ɾ6GFhj%ʻTYrL5?jyQúj4ǿDݕa:pϲb +&Xr>?,KB ^h G n3< !v)p}M!AN;V7h`,o<4`Ԁ5ٔ:blh(w: 1ʹoB ?$B1'F< Q :eNĺ}pj@@ (#M]7O7`%"{~>X!Dw(gتS]*TV55ؤ-9">/{j:1.ŧ3ꂐ<%ZP(ep}Bp1gE* \%.c񠷒8HɽL?wH؎+Yi dխi;8i$C%?p2iWЂMZS;{ImvJ}gbYs?rnΘn=pW/`\׬67!cu'I=i՘eN1-޽^0AO,ԗ!Vi;]h}bC, ҂Ґy<\%mU/&aaK4;w`a]V{b 75b{$T^ o8 kded:06W ˛`E긾Ee$-:܀b#@q\0a4(OGH'1++/ I2%3+~0nިg-e 3#0w(16E,j]V/I?01p^!!D vL %D]$r/LX%YMyD`.!߃dAwR1hP3YD| .Y!k ħybE{Ti?<YJ%\k:#6?# ]X'/ z9ufC<_F9&{wKJ,*p1[ XXzS㹔AɭDn#R72*[$Hi  NI8&^A8d>Z&h6= ^"me$]˹Y Hb|8kP1 *+.A\ oPZ#?D?ݢ3?L~[uj? ES%kpBۉeۦ,)'([uu䡵J3WMT)raeȌY5]kxV16\m'dڣ~U<7Z 螏cusA|`%p sŔĉhab7{ \D;oFG ҢC ñOU4ɍYzfȟnmK7Oʫ;BBb~IU~Or^QHHJ[Tfcze{'hNB-Ƌhrgt%2Ff4pߢtcXnMH3!EԂihڡ]$?]2Y{iˣ>l?F:WMy6u7v'QQ4Rl'Sm8 WTZ/;87H͢]3~ |.M#OR-&r1XvbK"j&"L-U6rH łƍwIٚ:Ђ"B.?x](}-UF|Z*Hw*rNvImP?AC{И;&DҡnsP1!(˧@"XYPq# "x$l`n")Cy+H1fF5x-iQJtk};T_>#긄l ;E+%X}I87@D՚dEB*Y^jkj5棂?0+v. nfy*"dWȅ!DՐn=ub s'^زwi3 FbB<˓Y xMq0>,Q3E$%5KVoCp5hz+\Ui'/V҃I.m"nj2 l?x|^qn 냰`Iޯo0_"S}ZHkqd-+# Nd{8:?.ݪJ迉mPmA8Ynv#6J[L xh+ AI=p"g$Nӯ;_)1ދ NS5h;6 6bN|b僩'C˵4e4lC'N4s, Mi)???=G{Yv(S0^09R'}%j"Z,'ЕE<ӟHU~ٗU}k&3&R#$-G5Z {qN|xૹ_:4eeOծ.3Y׎qYaZgs &ļV gDy@_;;~Xinv/?+i1b[(f 0(_,j Y!\O4TF(;8ܚ3m-ԙ"΍vX;|< FָZ}}ڔ˺xƃ_A]wD?ʻYKQʚ)|iM'~O9=9)n1\E%EQFֹPHhL *a@j#]EsÒE!@9~@>={+1{Ѻf6 X^DOrrq=MK3y3Osz˫Ar+hr> .ϲ ,~*JX[Gx|C:mZl'ж_Jϣ$` WʲZ>oXkJ e2ka6VxlVMzwCA;،!PB:i]Eʆ%|iGԶ߳;Z;8ޏ?Jnn"XnDhcvX\Һ,+&ХTdbW3:Ťs/?:A^=fN? _.ӳuf,%p.s8k:i?v}M9v۽h0oL-҅dfzE+>cvsfY3ljΒBG0,$|N?+ϞdshF]ei5X gVʓ@qUP w"0Y΄ SqOUt ҽi+`'ruCHpf۟\gerbvߵҹ]LxN۵ћM/ M2-aY;ԟsB_GLKXEMXrg }[̤P9 \,52ɱ#@ *@TnslW >p]2@mMqIEQbqhK|l t1̈??whΎv؅  }sDYZ7-6TY:*BTqnɹd?YkH3:E2i^JƥŤ $dmN㺉>1'=\ u(b>qi#8/T=SI5"9$2҂KB姷Kѓl(:h.0u,r;BgLnnňZQ-.Ѷ;gJ;-""蔓=TVn$Oè9\7/r>ͲFR2v✸؉cbֲfuMiż`GvI^zH^v*^lٿYɲvDBsDǎyi_[[,Hr~xxiuHl*6Eƾ)i&P?>z,O&H{QP88T2LP]N2[PbU_{ ,E\|ߜ摴q"0Ȫ[Lpx|!QoA`L217Ν+1j ËIJ3J0+1io9"Z8f @$Nf(mAD0KЛTpCy01VUo oѧ:?'9)?LݕEt@Nm Þ=v&yxb᫯1QZY ?y>lŹiDeC:殓^\GcB0=!l?)⇭ߕB!&~^0*gfM v+ ¬YMFRw`wd-X<)su%SGx",FӥaxQf)9Pä m%݉-2D'}Mq002F/#XWTt?=%M K.dz- DsBy"M{",VeZa@ yy8ğso0H^[DiD"DR2'C_[N8T<ºNqC7nfY-M 0 V23iqN~Ƀ[#䯤ix,!`'ήiȂQ+ _10|ML`[>l.8 x7K;RfҸv[pёIA] 憄[Ov{kb͘_;_O+Lx"<,%m[ 9n_=R[I>BUM=*~z5,.hs3u?iЬ|SJtZRTfV n p1jL5e65Aj Nt(T0aLy},9_uwݥKIh椕6=qr>eiN:oYwJv$RR)'ru W}?R3硢`r{NdS`b)ޡD1tx &k ){lQNNgPSxbMS_]l7׮Dݍv{G3Xƕzb 5)GdǑio^ XG8:&_$=VfmwO[ZCB[d Jh'Qgځ Zm;,Z%60)h ӀX3W33sQK~t.Xwae1v[pc+jFE84H,21lլڨ o\a*ّy4'PhGa ^|eAQwIS}%VkE-)D{߂Vh29Fk$Vi0ʞn3r O{:V|~h%]۾lKs-薗}dFW,м/SS HnVyM7#[=\ iQ!WpLn@Fqҫ(X i-җҴmβ~v2j@{z'QkXl+G1J+l].kWf[' I ȯ&]+U&iQgrH XZZ]%%}yC2@V1AxSF:޲ i!geh^PԗѨ֘~܉y\iRi҈z =es%z45dMkN;}Ǽ3n~FA#SLv 8ȴZF_҉y`ׇX~t+jcL!o2XbN>JQq Jj,^x$|˭xًy4~/G^xBus!rz?Dy1,%$idc=[4n9vzPCPw35xC}iB_%ʣ}4[O1R"ѧ&K$}Ӎ!i,#x\|dI 2D.^p?O I!PʿPȋqHgyQ$ܚg1a:X\MMdraJK (GB+X-Cٰ\/C{'A&T sj}p=ea]a:roR,#ĸcNU-?5[acu.iU2TN<߼špf^iҐ-~.qk^m) Q CE*A߼>%;90N?PPҧn@Ǝ;-OAuFc1Z%m.уZ1}UoA]J*dgcVD yxN$5߳k2Y$ Pl^_m#0ӛ&##Z7%:zcdm}yG%'<7|䋦HoЀ-NR/Z8" )yww9 Hx>ᨌ*.{eM۵n#jB?Qai/\?cCy0u碎:%֡lǸI}i\aI᳡2 }8VoCIHk85eCs2z:p !W!ƪE j~KKD!O>Z G&=TMV-9H]rIwO&#ԑ_TжǶsJ{֖)F]HW e$vv렒Swvf"eKdfoڵ}|?!^Eр \*/vMH#E C dQ(KX7Uf"UGm\\LP)LMahJp1ӷj.t'V :8P=3YνZ5LUˏ苽4KB#g~G#nP:PbO g${{C8N+1w?h\0ɂdD:Xa>ܜ<ziqؽ곷:ӶG+_ tTɯ&5@`ޜ2`G./V]"$lV @zv +/(#gWu 1-+5bO;c j:{gɘ(=i hK<ŭLXW;dN|oXҎqhF;7y~YGb`GىA>#P6Lg4Q:$G b6g UA\x#ocHuEhNP8*(})%m;k/xjjAĵYbf߅rŋ:Q k 3;j 3bUuQh}$34n*+?^/ʙ=d`=Y7c\p%- NȀ U65YS&dE$yuS1~ͧˈXl(K p w (hYO/E Đ^0:Kn\%n\]E ݬxt)m ǰsg*>V#Z>TΩs7b L5cї7ΩD.r!UvTL (=@\/pvjeeɇCW ^ڗע}5(ˁsTK I~ ěb1ڂO0~|lt6pN=UϮ$DM,էՍOR"D>Id$#GIk.L& "g!i(zܲ+G,'Ƈ8+ ߦӛxd\ E۝e/ERC4mZG>5Nyay,(kW?瘾˜c6_N&ި9]p鬾xEzpNmĴ3=3F$8h܈t} 0psCPvxL.MY v~bc3Url_dn),|kLpeUT`˭f1F>Hiw;́9;VSe%oqXG0 C*H+셆kqcXY-[ե1&n0'OGƉJLBVvivc26'fȷ a,9lPG{Yȧ|Y8WBTn;cF~!=L̤֣BvoIXi6zɁnؠ(̣Uva3SXXP}| -Q'^8ɚ#q6ИQ>h8w9c*Is4m5K *XX\Xk[-60:NBhn$\,ѷF2ACb%>ws|N6Dl3+9( kguZJJ.HEsXn 2urG"Ar8[XqU⯔* ,3rc'}ku~Ф)E2$u9%20">0WBٳxdV>G!0J_.<L/ ˹wM@#p8D4Ҭ":WWrǤ_ǃvy]0pg'é/ (Nvj md1qg0ݳW)mԋe_]EZ 2P/Y?r VbR[oHi)ݢjZ+ GZI>H)UdntSH7$)4R"#"~2d Gp(7d9y+wLzyl y&IJ(m >WΒ[/g`-|~|$JYGe#}(+@fvF^m$b寓ĮR 8`MH1Ӽ;S%m 6U[5=6Ay/V [wb̮o5RZu@7:LZ')t-RW tY{.fu IZހ-`X,p\Iȶ U>{d>5.*bˎHWl@&pǤg,]majwuO.RPEF)dRUlx,0Vw#:"3Me,CYQa#ј QC*!r>|O-J_"1;hS'F}(py~:sw`+nnn%C\ xnkkiN@D0~Yωj-[Ӯܸ9Uqb7^2p_ I7t -4޸db08i'Ҕ"ܶVOThm'UЅ9_1G5-V$>'Mu.y456Bէ7a%3.O7n޹7.PZc,uxzwٺ=/Cfnl63.|Ę5BsiKnT('"5W]8,P'A.@Wq/g:oU*y>y)7ۄmLŔ [Gy)} <F1`9.n XuOgq&88ch܁~+/׃\ dmM{?wm-M*SN;I IAgSX=[ AG Y7'/V DZu8_iIu7ݮf]ߞVS xH{ l*J.10Y$=FA/zmW !vHaX{zy%*)eOR6в1EZJLٖmajaO\'q ȮéȚ&&$ɱ"uOi8DNCiX\ΑUِĭ^T|x7l>KYoʙDqBQ'9p`jU!vC_[iF%NV d>8#%nfQ ?J7N.+<y)U,DR 3Vָ!Nܶk4N8llgLvrDD\' ίj{-CEaaz)/rho y4#nHUDNЙȌ¨QBBEgWEh|5#,:`ӣFmZI ◘xѠSړUpK_VY>ki#d؊z4UBB<7ȑ>ZxxI۩mkUҗAқL{[c— K Zާ6y/pil!m&x:;^-E0}G>c4) E 22Z=Bot PE+\V;M L $FY({r{fAv!&iL$@KE ip?ȞJlgm!;wk51k33 3pAҶѐdq߆G&X"h-=o (gM ytmEDV >"wO8_RETi [~p3`Hw0G!^TIx$YR1$pRќ|b =61è8bR)U2ƀYtVixfeI'E`m~g(9vd{|p*!m" Fh%4qke0` /')z|I_UxO\q!`ߚN5kaE@:AEGfTS [ftܟBqIf)&2>ӆt.ԨEFPE&MX+vfQ2Nˡdx2rJӏըWR XoffZ'(0q"G5 J.x^^_hgtRR^3CL~" l&Ë.X`PY$c%K;:I_IjK:*xr" X) M988q ;di7bmW٦)=#-~g Po"(7k$9!~@P u׆0g +OhL1cIc;+Ԝr|z:-2[ ~D%1I ?XI񼧬]:O3eE m1z+|:hʉ *a l(^CrAZ[Gre8S/7r}OVLd\=IiX5%|VyoQ:7pMBZt#=t[Qs=K#qVQ@SJyXv:,u2#\.Nn"7gn7ň/Dby4 tzB=|~wLK| ? s;s`j_5q՛oM\YJv?߸ Ӝvc*[uIՏRuSE o*01ŏ`t{Lٝ8)Z su$h4DfqEB1/_X9Ȃ| G(l/xǡ v# ȱ '^̝q9;#]߹ aSNQd1…J7C e@@}y7K!rIP6 3gY=! KB#*!y=Nky0)YzUK.HɌZCHG<FDhQ߼%)MZYOk|; 7=_X^] X҉^Zhg(a2Ũdn9ȦL6'5Ƹ!#\#+]~',LPFRp?1Zu,|0Ʋ/krцkS=Pt9Kff'dmZA#T͍xIc;og%C= ?Ja,@>AҥtN\mUCS zR\ c?σd!t4Y[;s ᐏ!n3twqE82N3EQP-|Ycчɷmn,mW5T, ]f/ s%fll]<0 qVX("8]d5kN,y*Vը4H.0q 0xB )+C0ͺ+sЏ1e3KqK4drc3rj380JrvN [,5Í?*ddG1j!Zdvib SʡpKe>4K:SmФ (+ ;' ҝ\@OHɚeO^SLK/ Wp ;As ۂwz޹ ҧ`z5k\G25tye$mDupc@^(sc]usd]&PbtX iI9?J1"}7b&ւGoɄݭy4V"i4(y\ch|$ݾf}NN3jE(zg?LG=Ўi&O"[19/dޣ,Tߑ"=-D#8ƫ_`t݄>qG!}?XFO7xu >?Q94pOؼۺ\zj!چ3[Jq ng1"L3;$I%ag(v]kP+obǶFϕK:9o~P vmo`8\g}^ZoY+ϱsyAx}ɟw\S!283Vul8>YˊM/mOD084mK< L {-PNeNJ +zcd%gt(v$٧8׭K1yi=ot}Zvi!Mymh^c;_}-?e*'b+Rv9}Sgeo\;`E /,KAZ1/)3?Ǥ`9J+gtddcAJl oTji {f횖>%Wժּp0>Gv|1#J-т4uK{{ "x"%uq؃(UbRC:JnoL¨h}#Y*+&§0O&h/.d~披 c_, ϯ/`|#_GB( $*}0v3T~$wi`W56j.Cx3m /\G Ax8ѯB(5n1L7>)S攌gG)*ʟy9$=cq):u$%ܞ\D̋2T˫}W黈B%ۯd Np팑W/LL[]8hC5uǸhn;WstC\D/;L23ƙxxB D0WސzGUZͬF$dTHif}1PQ*QB0oK.o@-F}Gz_x;}mT%8-pkAܭ`T e{:K_"%VM |w-?id_QX(U<}6O ;Sp >\J _fǝf=ï=;gD|2BV>5aDT`u,{Op^CyN`xchi?Apct=BbscFLb w=+蚒ebQ>ŊmEqp)7Q>Gp6d~e,A;h65?yKQm/uaTҊ $vs"coʜ*p0 yb5~s*̮edɵӶ&P:])ͣNڗ[iXy@9nůܘ^X x>8Ծh~!ZԿ)Y> 5 *V¡ڧɓIe%s7v~bD,!/4Lb%e񂒛3#b6|yxE(dEjUW+WfT5kO 8Ϣ[MOr$쥂0-N;dStq26`?!K],=ĈZ"yWchlγ$!Fq&ym}Z/@ڼPB|ԁ2nHnѠ$܏9 ^%o`@[}$[AG?`_qlEѨy6HoȎ[*woh퉤m\!dzRnU)܍[LRPb1vF#T(kێs#`>p3dER3E5ThRn#vU΢HۅTVrRBYAf%=Ьr it6D$G 'J 8Z銄*+󟬓o- dMGHvqE0o]yh8x|ӫqT^TkW5;ۆVIF"B&bS!&0%1` ʶ^=m%p|'XɊ9Z^TλXyosa#e#o_~ ed:CJ<` EUazT,G?ã_A[%_0RG!fF}W7UH4E4jT~"x7-ܱM1b'96*DO_37lJg{cHNrv4@ƣvBvoiFYY43 AyV~.]=<<wKM* 7dsؖ3[p'  Ѣdʚ*X= DV 0᥶7/ =.N*粣hnWxoIZj'hg\|? ^:qZڏ`ʮ~1 H j5ul X#Nl*%hTMJ]x O’?&% ZHF?~Kx@~x˕X YddH*E 揷vn Cl7a~A 1H4 NZ ,_SIlWnB4'"e!B/7U8ex=| ])a[V=83Ǩ-хcEJ龱 [}yU`{ƇzC+%Rhʮo+t:S5\bd1$X:ʵ=m G]-9/<Ɗ9iur^6X % )1_,Gҕl rAx&k⋭4{jz+ QG=-{҈&rB)Q Vrt\mMfASY)JXÔ~_Fαl e)]fW1cwMٿ8 bERK0Y%0k$6)P{\Mp N|~ ىd|%5+b~o6}BL53 \TIE(8GkvP[pfrgWc]-YjK>z*Un+v¢Zv?ZH>)' `G|g5S`;&dQ_#ϙDDe*Q VagE)NM6c+ão-#pfax8Z Ȋrb8E!{-̔ ߥv}~=iiFm>hj3Ý,ȉ?\"]F#({4<^v23kםYSWT?\uyެ܁ 6ԑ[ ܶͥ(9_^J>M)xId@vzituZ >v;˨ H#"Y߶e܌-3= ?>AnBK3t$^`/$V7),3Zh5 GQ=ᯅx]%2gt9ҳb ]0FEU0\E"]w+@5mkvh$B- KOCqx+݆NmWmELauXi\S_󋷳i|-VJ7J dhמ+3iP:]7_4vʄo(F!4 d`%b(gʲ`:,yaυwY{t7mW|6CE1y0\p4#/__= M>FfTDixdb(V|Ӑ~&`T޸9BYR}XSbSœYQy0#Է(mhNYls)Q`,g;V hQ9t{}'+[EZ"-ZZ 8GHװ \Y-t]!oHdQF0 K-YK %=K%p9qHʹ]1a8ⵑo&%Ơ&\^|k@LCP 8)'*Ao̿#rOgݢfx-*]=F8] ?>40rh ~3k̉PivM&"s&u"hj)`n$hda~Cʑ ,xawɯ/E3^8ґ׌WPo%WQL #W5+45ypCעb˂Sd)uL7{lLM@¡|lA/6xהCH*VyO鵦:Է9f_4VQ*N3"OpVU[MCh s?zٺ YXig?Y瓃ǘrc[=gi$4~eoЇ!Uc6.=8,@h^n|>0X5<ɖOpE1::P7D~*R{+a򧿁U_+] sdI.I37ܝf5'__ƒ h曏(5Qd0p m2eO; 2I Gz|Z7'QޤD~&m[S yj߿89uA>Kh~٬3E@TQ_ůYE#{|N+" t#6͠[6--q<(eʘގZRW rqnje mnCX91JK)gɝ'w8K=<Ha֧HèIS,l>{J 3Nd裼p &nGJWulh~>t&JG+~'BQ.UJPY2jH;XˏJF{WâX4`\D=Xdn K9#~ j%df^ %%5Rğ"j^Ӎ-:b\.6quu\5¨4I׋ Qѡ$:J{&JSN;) |-b,.\TRE3A!78R7bHϕ\B|nǝ~~xR3 az}'x3ٸɽ iI#D6!L~@g^R!3[ "`Xf{Ak28_OºS za2:wvx%0qSlaf[վ1&z]T2J84t5YuQ>Tm)1!qS0z ;XMW!b^SOlٚ}5y]3 8Yi^96yà&%,sp%dA5]8XH^ 'ǘBؔL!b*xpOʈo ٞsI%i,6m ƠzT5a~߉wFGWeDm`P;\J+k{¡нwAVg)4D+}x $ݙ۱ ~@C7X0-RfcPQZ/-R^apqtMhEm3 [y \ɒL:1zw(s#<+ zi}}LT]~ Iь;/F}` nSuL,`n14ehv e7f]V/xVet*%&Ua0u) Iq%UlYD"PBǔ嚩_pFK}5'kb) 05[HȖy>VUoP+ls/3",`ρuGҢpHCd蓇M?YpyfTR_CdI&U``v,.w$m> h-iy{xkVǭ{wYX8xw\mq,s,CwK>kS,7._QA~tnck!C<<@5%g#vf]H)J)zRٯ~ڔ+Ut=U+&ajԃ|eq Bt=J^'[/N:` ÊS{JLhUP4+ü\r|sZ"{LpE>h8'$@VJ xѧN 2%N݆Gƨ,#eNB-`T ;cTDZ#n2n6ߖxuGpeH"@Kg#?MRɆױ5,DVqDd(tm!m ]0h+qE B&&Ω7Q;2u٣?z̠ 5vdIG$4v|x%F~QqS֮dG9HI#ibd ?液XCN#Y*@qWzm֢]h\ ,ZUey/ՠp,f$#&e B͊?3I@S `Ӷ7uR_ ggMt #pq,<ؽDc=v]8ߙy`ZMpf(7wF:Yâ8K G/tQ 195TٸnFͿ#= M9' Y]2\cD6g^h=o`㲷 xr` >1Y+풟I&}ĴGB{Q-9W&kᎳ}a;Cֻl~̼6M!,3K=AOqk󰕇:no<ū}%cU/lB'I}?H/ZPXP-43eP2Ղ9JMc ӆusQ3o 685jiKYj ߚZ_@5JYv2;bJީ?8 csgE^el0,X sUnĖQ9,As%\$<"r]Uɫi~(N8O~uϗ:/Ff:EѶ Hf3W#ou- H NZ|oJzrT_M\v<.Y9¦En?lx[*̻yr_b>~J߶% ' ԩ] ! ۋtWk ?(nDeA8Жoq2`NR^=!kɢ0-n@4)M2ۻ ?xa̡0Nضb<╋A|&|hNKVpB ~S\dYJ!D6!P=Qɰi*"s\YB R`$Q~=OQPzE.AWP2qE6>xѶwdnk }#7ėQ Ҝ~ +)[f\bW_mVدs_PO]o"WCe,v4M7#)rV2LV W䑑o2gՉw|ު~ -N8?g ,WC%h6r jR#g1Dd\oE a s9-#Zwhz^~.`镣H Ճxn8Ơ3GKH ˩D+",{k(w12,)D,ۊ;L<:#ie46&'G4_hk~Ia\aE -:g;Ȗq;\ax8;0ܶTĘ OMMb_,t3XxU 2[>@Q%UT8z9DʐY0dlt="Ee}t)8t3Tm[+X%)ՏWY448WQ˕.ok뼙*u+Cr])wzM E CcRE u,*aȡPfBjOxL| "^e=z,#(C6JABu2f %ǷGRјts}xhel|5^ nm)Bb궐tE2aݡ .4rUSəut툗gg; |d!AkR7i(ꣅ#D{B_7Y `ۏM9ܮ*vݐNEO+>]+irʳE 4VL<Ÿ >:l)%M,O56l(Wh`z9Ҹ "kbH>+>xi{&4LE.H?m?]ter|8:77mj >i0ӿje#H/jheձISwkR`"RbǞV>ϺJ,ּ}d|̫M#_gɩM |vV4]!E_.p'Tv!"`p1=¬/yIB\Öd,#|;/Q/) ;U{A٩O߅tooJۧ# ~w :;-#Rum]'G{T)CM_%_*W&+l jt"臂,qEZçFN3#{cY?\ X .Km9H[VMj L^F!({^}|o0[WEK9Th9'ABc;-vٙɀmĜ2JmE:I2~bbYkTjCnb$xUmLzNTCgS6P @ƒP}Z$㜠qqIđ춘c02g1m/Gar~1eCP"Ġʯ*/Z6)̳a?+-K3q\N۔53,Yw]1@~B\Mzr űنvak?ٟhm2a?J~RB.-nNkuR70:-5G C+>]U.XfqDW'* $?eٮX n* gVZ^M?&Qe 0{W.(q\zozre 3n|:odY b3 ?5ʕԾd@n \0R5gbeiZzaSχgRɟ*'`,,zpO'ZMh5_o"28w9z'@15v\)Q4w\voR>ɣbF4~3hM6`? B?2%uB֌^bqVë%yV}є 5 كXPUX @e:UH>Ij~ezKQT$\`Щ\e'spWgve.rZF3/!I(dΉꢂ] #s̞Uy3n_n2y0I~J9/#B:$zbQ=j11DX!ikz)Зk(?b<Mnt lr>1XmkR{&a 4bRy_C6d9bǦMWЖ =NdF,{Uk4UQ|+Hm׆X!LwE}bUe2wfV6m8rZ3}sǮ073=}i) $`+D;Np)i֌#LUDĥ:ЩUFW"֓0YTkpNCߴ'܍Ϳ9#+XcxkgKQ"s85fk;Wݹ2p?v8Ȥ_zu6:iX!P-&I+aOr D:IEӜ;ȿYh5<n\yᘱ"NO/P2P^hM'XVWʼ *Z"0'xLg!C7IaZ%9۵oӱ)b-'W&; På0eR2XShҬ(*-n 0WS>r5+#q.dg Q_P~J*j="yQ)+,?*-Գ+=/ K**te{Nx )$6qIsiFM< 6W ߺ[J9С(͙#ײ1ZB?VO!Wh? +î3ci=D53ֳ+P$vXdSQŻ8J4o_CvFn{׶J]Okca;ވ%l s)+vSf-,Yy2q=%JIskla6,S7lI<#azH9窎Q_m3 &M_W|G"-P6M ZqmN^߽q_nRۑcL?gv?;h3gYjk_\ ,Ebx4YH/*XJ؆trȊw@-f}q2ceUR@u!4|OY Ʒ`Dž\. ˨3Nkđ/f{;T8NHt}䓫Pw/uC>hNF[ Uୗ 8GȚ"#ަ ?T-?"/\薿}ͩiz`9/f 5smcwCfGH0pƦ?8a^[z EJr5a4*!Ŀ|~ oIo{dN%Cp!A>Lh25Mi}.>* sSc9} ۧ~'ŗ|a1rAx)%>vYmdZq [TJm5iU ְk˳A)hzO (Yŋ~Z7KU>>DxOT+đFhS^FH PJE9oMeׂ"lmY"!P1S[nΌ/) _7Il_= ( 8D}D賎Rv{vXj$:eXbC@jdD~%/'\KW|)gȓoKu IXR b?kg_qvJҼwx[#@?k(}f<8Q Յ7U<I<=a)tޗΨoIUb]|۰';C0] )ȥ@_ k h`$ {rR Zڛx)]a%=/%-sN nVg”,6&hW2eYN7B!VU0DfkM++8kQ *HӉ>Y4~/z3t ܎ɝˆ<" _kl:' ?K~C90F" p7N7O^tB݂><zoQ̲Rgis, 85鎍1w/1ʠ ,e1n[H 2;d#X]c` )+{ s4zND64uNVcin;-`z! jDw 0g߸lĽˉ63%FgY*ܤT gHy|^5al]?S.Fw6L% 65qn|O)WIuN ةrk_U4?&3}VUEYz ƴ-zÒ>Zӫ dvpW쭉/!x2Npd ?qHiO+s » yh6MpUM\?2Ae sݖnh%S`\K Z`DZ+kdOQ\%Wc?Bo}[n#Zd21r6%\8'$ۜi|XT#,,9:3Qbfj@H)?)M.x _KuT!Ne @olLm㍙OU"^Mp= SZ;`q>w͘,La5HV^{RazcJ fֵW+ei'$y?ҊitŚyV> /V3j+Jwb1@n;ZG0胃јـ51+ggtsdċԍr٬V:?? x}+OFvrxj18 r tm ƅ)ܖ8]ۓ= @2§* оX5[p΃3? 0%\g,%">{{P33&٢=.@ uXƬO,cy mܢS a[H*~<*{V*=yu6FsױP2:V2Oں4 @K\J/lr4tjyy;GSDe#95*8TOp-/t?R ᗫ]7͇}JPr^#x5)EKݛ_15q&]q@SXiRT2c|K|BL- lKOAOuлCkg5JԁJ?72`ux>, {ngsBxO%J>zds1Ҍ(Ŷ/U GpW(QRGt %9Y{p"^nS|1tFHBB "X)whsK{r٨髋7T{Hua6 4õq)7*cc߉=χeG[ UxŗهS76FlngdRz.NhH#v×kt"؄dMJ;UZT.h5\$WX 6 Bgt"k*[ ^΅%|M~Uw,b_~+s hl:7_<Z֘,MNn^Wޮaà`AYvSJ(XnT@'z_X Ek'Yv\sr$ig_6=Hgu!lCY⟐8iZ}[+OVLfMBESgv+ (6ACwA-"` ;Kllb##^)HJs]۶5:CrvK䯟u*A]QQpx1#JE ݔjYx˧YL׺{LjyV7/VW8}ʜ`mn K G\WY$u_tjGlx°o^&4wM[;)> 7+ L>WX*1+m55sP܏ʁ^t73ǰ̚|F B I;P.FRxՊ@M 72eH;n#\Z xWu4/iagơE$sia3j(V9^+E2vx|c %FN3ڱi1]hb4‘oD͉مmx=t%n;3'F_@^ϛS &l66`ɚawK+SȕuZy#$]_6%D#oL CW3x_69v=K#2J {E#000^o5mL4\qO evqNMJzz1SEĎVJwkF*yTN<eylxˁԨݷTURG1Ttu_yms,a[ov+䰏]|}9{@pWxA3.{J3\΅{lN̈́b{ 1YUfKy x՞n&zz ]p3`F@q֖01@oPO^.^hGҿWų~EucOS&hj<;srQK:$PX_l*?!oL f jbNB0rZeqb}ùܨh]`%c,5[Y*r+<ե[ը nb@gYo$!8MI!HYQ_J]4hL+4A:D͙jHŭs[zըR0Qc~Կ 8T5 5JackqkT;3vϭTUb)x+R9_˦^ d/2h˨J=b_gmm?mfEx]ín)TZCIpo4UbcoeMtMo_:ts7 5x:pV2&bmV:ͱM5 H!6Eؙ\D9@t'P r3ᗾw&f57ARÚShI݂oMԣQh졟*޻c¥~xl)D> doc)f`9b?"9<>5ZXI![fX"MobY|Ĝ.@/ s\ }MyJϐ2`կw+\O\~ k1ޏ/rCSeuo3X8nKrp_IHc>0z̰uXXz46-v؎Y>aOS h(2I=$ۈ*bqaϦ3:}>UixCpi/Mƞ֧j5KbcȓGk-Ajnڭ5 3\+^$!II_kc䕕YLՆG};,^&v}סfF`eKXWԒÍ ڔ>APevv%(w4xyޤUPA#O6Q?{25?  >Cא?̶ Uilt]ytd3tYps =v.J4O5,sh?˰P+I"hVܜ}Y,wr⧧z*J x[odP7v}jҞpVuVº03*3@AVUH9~>D.e8m>2igF8=/ ]:9[{7LEtvJ6ЁPG;0xӥ.PI҇@FkCBq-3g!_S;Q@ r}6*p.lfUϲ0"mS+ޥ& Y_qYJ4 +W4ϡ]Ͼ--rU)L^ 6,Ne[ʹvty W7}IV6UO4k?k]mcF&ܬuƶiP"@bFi($f](탳wLQNƄ-|Brӟԯ4yT$$bk4DθiK 1(_s4]᩼P/\kpTg ޶.Wwi/{=CKT^}>Z̺6Qbds;6 \jT,Y:BUτ)g)&s+6vXJ*v8S/1Su pGm$VxP~ZI‚G0,ڷa8.~d gik`)LtK3G^RBE$iֳP0KF 訦t5=f~#8CD?vxlf]i܂VpLk/,ةbdf1}9ɩq7Lc!P"@s}ҟ}2vsu'"?&NrMP菩MN%{];tEHcm"tʜyoE0x0hyv*ޚ _սZh\>t́5lMZP>PmM/8j%t&8gX&Ϸ~ {}Uș1zԝxV(Q` Oݣ` [,Xy3ι8kX67rPѦM{ )¸| l5iX['IcVUS;I(CO :HFY\fg'B֓ XG/9L,Jx!ԕe9` bk1N ~%-R`Iǁ.TKM(e7*~L`8de YsABaށd=^ğ?&N P<\J4U0:H-r$4g Y<'RZ9N9nHU'iZ:>mhUf[zI?ժ@=Fi`>sJ‹T?%6>ga۟+}%~VSj7$7 ~iFdyvC0J$톋ca*:hk $8d$* 5ڂDpͦHH Rm"cʺȥK?|dZET/,w; 0Mӕ@lpnV[؛ɔl{½.WO ڻYV(,er]wdk &ؗ0 =, [LYVW~}oK6]Pjvu7$ v6xF7>ڋq)9Yjq:h&0WQkl& e>&7Wr+dܦǜ'_aЬs/e%;*!!$RU(gn$P-_}7(M!^`k]ύG"٤oUp򐘡[ck5ڴF "c:$6v*7l2Vo73>e xeUz9<|*UKy Tot!m!va Fw ;L0_mPbgy93`HZݔUE-5Pm(bЛ1tT~ŧ#]AU7U#~DV9p]sF]wǜUjWn_MHgN,5כUo2K*6qs#,e\ фBrnkKл[jyu)G( NY$]Q]: dMlɻJOJFļE {J/asQtp("NBK(ܰ EI_VRPh<\:n#IR{J{c }*}( ͦl*4vbS@Ԝ;D k)SV*IB"?(Pu'7:J Si7B0({),<$cЦ5y'  ]4$/Ϧ3 k4E㡂,c.a|v/=I[]x$=Z6gOߦ,:|9OcGJM}&M q&a6?pSU~yc6fraøGGRQa XnVG`i{?1vQ\N2'lY"HiQ2_K(k̶7s론0L 6h~%B<2dJ-JU5aD3Bef-Z>j}SBh#-<2T#0R_2'lӵƄ~%QzF6UA/{Bei4``Eǭ% Zd 2F@$cSdŒP[ RGP71@y`iـ7&)kAlvwV;J/;c򜙳Pm[\k``)tHLGwo?0!SIT(տ? tȅ<ȃ?^־j։aVod4pG׭ê5XgL-Ƙ/3$TV\N@h^5hc{;I{V8Rpr-Ի_@k=LuC7$G ral_ޮ ,pހ[ GuR0$5 ;~Bd8 uK"2hLTh7V_yyzim<]Fl aUXXcNJوd$t,+'Y\|+`UDK\-YJ:l5 /{;\v-N^ |-l&FH g*MOH#I_"-lMsWt^5#@'=Vn2o3i`WBU\0iʔ<ϖQ>\.:={u dWpAał5_SXH._D%Dw&*>W-MeΗfMQZmmtͤ`Bx@ڇ1 .-40m`&'a Z=^aÙgHF;it›~4A:IZr':đBu4q'% ŗDƗSL{"nJ-K"eLώ]^0/zgq AN\4Ndq]c}G%Q{Be(\_eStl’9c2B#>"}ܗz0>TbQ/D[*R{Βz]_>S^oל]%^=}fq`0sbnCy5w ' isqp _ ww~_|i7~P(_aLܕ1]?O-^z-a,.VjLd1& |Fxwҡf!1{rfVj'@]qnA D!Eٗ!&GAPӬ iA1?5 C._<^WpS->aRW> 2-˞\bQb 9աs҄b)869Ẁ^Tk5PԮ( Z x0ДqAR9R>f `6uh?h>ncK 6#ȞL)u`D=2fEޢБ N+jhJ4&H;Z3WۧS/`{_V<|9)KҟC^Nyk ᝰp]\Zj&%27@[5> d~~Şug\GJU|eI>p::cJA3xm`.u8e'sLY!Ɏ+uĐN_O%Ibjb _JEx+jӍoj1wL(mfk`[Mj xD+WӉE(4MczGF_c*`"e [ nl?V *ժe7xI"o}F.ٽCRR]Q~ܳ&uF^FS>#8@ 'gݴX=|^{D΢" rfI*3x_b8?l I]y7Y?ۻEp2qT‘x5`y}J<'Yk vaP,{vζŒᇜzƲ)p2|oسɗy&'-7{̥aAN}+]o'JIq%wv @cvV,Tl [E\} ~U,9cҶI)\T%42CωwSV KB`^F%h]b')ѫf8,Rj9X8p[">"UR>Z_ٺP_E,xPS6A|&Q,tr R ];2S;5LMK|RNvEdޘv=PكԘW}ѓwO eZgElܬL|b"l ];2PVJ68hhօvh0+F.:(8Q)_Osn}'*tvK i 㮖)* u[phHX)~a6pTg`*4͹ԻX$h;3B:m,Fj-=Y<bEEXU ? zL܈P43~ ՅDE!5d\V(r 뗄l̀Q55Ku(Q9n?:U"bbhq+-}Z6sw6-OīM35 Po5TžC<㓕v`'{:2{ ټSϹaUysa=p,F৷ޞaJX>+5O9Ӥ(iI8,k$}Z+Cj=$Cdb ^XLpv9XT-cwIcikL^S0pYl=ٛ }2WZT^Z]t4<hS|sOMϟwRl` f8 f00@WDq>Q;ylqͲ߁J_gQ6[A[tJ(#b;, t 1=o2eYN?wդ9&^rYn!HH' +;x&Gt(W2&u@bGYo|,UbgZF-úCakgOn6]&_(*hJ0~qﰺ^{Z1Ӊҙzq۬??h9]3 "U{XR_2eg` .'7"Z=ݠYZ/Hy!66)O| eH З5_9op:,zhGljҲ{=o^: w4HrJ y0~LiX3l &9X C a|oBRS[tJ&h{ lDG0^t:2!]P~6JAx_k>f7aC`bܾV1KFQ,kfw <{nܶ YZ